DOL Public Disclosure Data

H-1B Historical Search — TX Professional Services Vendors × H-1B LCA Filings

(raise this to hide one-off single-filing vendors and see only vendors with real scale)
Vendors Checked
3,995
Vendors With H-1B Filings
783
Total LCA Filings Found
448,453
Total Worker Positions
1,038,034
Vendor (TX Payee) TX Payments TX Total Paid LCA Filings Worker Positions TX Worksite % Worksite States Sample Job Titles H-1B Dependent?
Ernst & Young U S Llp 4 $679,114 85,251 85,341 13.3% WAHIMATXNJFLTNNYPANCILGANHCAOHMICTVADCNMAZMOSCWIALKYIAPRRICOMNKSUTORMEDEOKNVMDMSINNELAARIDWYSDVINDMTAKVTWVGU Computer Systems Analysts; Accountants and Auditors; Information Security Analysts - KBGFJG101912-9; Logisticians - KBGFJG269374-2; Information Security Analysts 0 yes / 85251 other
Microsoft Corporation 1 $66,786 75,018 151,081 5.4% WAGAILTXOHCAMANYNCNJFLSCPAMORIORVATNAZMDCOKYARKSIANDNEUTCTMIWIMNINWYNHLAOKNVDCDEVTPRNMALIDSDHIWVAK Software Engineer; Software Engineering; Data and Applied Scientist; Product Management; Product Manager 314 yes / 74704 other
Deloitte Consulting Llp 59 $92,572,888 36,041 61,615 15.9% MACTCATXINMIFLWIGANCORTNNYCOWAILNJMOKSOKPAOHARVAAZMDNVUTKYMNNMDCALRIDESCNENHLAIAMTVTNDHIIDMEPRWYMS Senior Consultant; Manager; Senior Solution Specialist; Consultant; Specialist Master 282 yes / 35759 other
Accenture Llp 43 $30,810,637 29,849 30,261 11.2% PANCWAMITXOHMOARNYLAWIMNTNCANJILGAKSCTVAMDFLORAZIDOKMAKYCOINUTHINVSCMSIANHDCDEPRALWYRIWVNEVT Computer Systems Analyst 3; Computer Systems Analyst 2; Packaged App Development Assoc Manager; Computer Specialist/System Support And Development Admin 3; Computer Programmer / Configurer 2 113 yes / 29736 other
Amazon Web Services Inc 50 $738,218 28,832 152,547 18.8% WATXVAGANYNJOHMOILFLORPACAMANCMITNCOAZKYINCTMNSCWIARNEUTALMDKSIADCNVDENHLAIDNMOKRIVTMS Professional Services II; Software Development Engineer II; Software Development Engineer I; Solutions Architect III; Professional Services III 13 yes / 28819 other
Amazon Web Services Llc 14 $17,653 28,832 152,547 18.8% WATXVAGANYNJOHMOILFLORPACAMANCMITNCOAZKYINCTMNSCWIARNEUTALMDKSIADCNVDENHLAIDNMOKRIVTMS Professional Services II; Software Development Engineer II; Software Development Engineer I; Solutions Architect III; Professional Services III 13 yes / 28819 other
Ibm Corporation 3 $131,322 19,741 19,741 15.7% NCNYILTXCANJGASCPAMDORMACOAZCTKSMOLAFLOHVAWAINIDMNDEMIWIWVTNKYAROKDCRINDNEALUTNHMTMENMVT Application Developer; Package Consultant; Application Architect; Test Specialist; Project Manager 100 yes / 19641 other
International Business Machines Corporation 2 $106,500 9,930 10,011 15.3% NYMAPACANJNCGATXFLKYLAOHIDWAOKILCOWINHAZCTMDMIMNMOORTNVAKSDCDESCARALINUTMENVNEVTRIIANM Application Developer; Software Developer; Application Architect; Test Specialist; IT Specialist 16 yes / 9914 other
Citibank N A 20 $23,905 9,861 9,889 32.2% FLTXNJNYDEMOSDILGANCKYCAOHCTPADCMAMNPR Applications Development Tech Lead Analyst; Applications Development Technical Lead Analyst; Applications Development Senior Programmer Analyst; Architect; Applications Development Senior Manager 865 yes / 8996 other
Oracle America Inc 17 $2,256,511 8,724 127,435 16.4% TXMACOCAUTGAARILNYPAWANVTNNCAZVACTFLMOOHSCDCORMINJNHINIANMMNKSMDWIALDEIDMSKYRINEOKMEMTLAVT Software Developer; SOFTWARE DEVELOPER; Applications Developer; Technical Analyst; Site Reliability Developer 3 yes / 8721 other
Kforce Inc 24 $134,509 7,153 71,335 23.9% CAGANYNCTXNHMDRINJIDDCWAORFLPAVAAZUTMACOILINWIARMOOHMIKYKSTNMNMSCTNESCLADEIANVNDSD ADVANCED SOFTWARE DEVELOPER; SENIOR SOFTWARE DEVELOPER; ADVANCED BUSINESS ANALYST; SENIOR BUSINESS ANALYST; SENIOR DATA ANALYST 6 yes / 7147 other
Cgi Technologies And Solutions Inc 51 $5,674,197 6,619 52,384 12.9% LAOHCANCTXILPATNMANHRIUTMDGAAZNVDESCCTCOVAINNYFLALNJARMIMNMOWAKSKYNEWIMSIAORMEHI Software Developer; Software Engineer; Business Systems Analyst; Software Quality/Test Engineer; Programmer/Analyst 18 yes / 6601 other
Kpmg Llp 36 $11,018,128 4,355 5,904 11.1% TXNYILCANJOROHNCGACTKSMANHMNCOSCWAFLPANVVAINDCMIKYMDMOTNAZNENMIARIUTWVALAKWI Manager; Senior Associate; Director; Associate; Senior Manager 101 yes / 4254 other
Hcl Global Systems Inc 2 $14,353 3,537 3,537 22.1% ARGADETXFLNCNJCAALMINHAZOHRITNCOWIMAILMNIADCPAKSNYMOINKYWAVASCLAMDNEUTNMCTNVORSDMSWVID SOFTWARE DEVELOPER; SR. SOFTWARE ENGINEER; SR. SOFTWARE DEVELOPER; SOFTWARE ENGINEER; DEVOPS ENGINEER 3438 yes / 99 other
System Soft Technologies Inc 7 $224,952 3,338 4,281 25.8% TXGAOHMINCTNFLMDNYVAAZMAMOILARNJCAWADCCTPASCIACOINALNHNEOROKMSMNHIRIKYWIUTNVLA Software Developer; Software Engineer; Business Analyst; Software QA Analyst; Project Manager 3314 yes / 24 other
Htc Global Services Inc 7 $149,560 2,899 2,899 3.6% PAILTNMIVACOMAWICATXOHNCLAFLNENYVTGAKYNVMDDCDEINIDAZMONJWAMNMSUTIASCWYCT Software Developer; Programmer Analyst; SOFTWARE DEVELOPER, APPLICATIONS; Software Developer, Applications; Systems Analyst 2880 yes / 19 other
Northwestern University 1 $14,700 2,620 2,620 0% ILCANYGAALFLWIMAWA Postdoctoral Scholar; Research Associate; Postdoctoral Fellow; Research Assistant Professor; Assistant Professor 0 yes / 2620 other
University Of Florida 8 $3,954,775 2,467 2,467 0% NYFLAZWAIDILMDCA Clinical Assistant Professor; Assistant Professor; Postdoctoral Associate; Assistant Scientist; Research Assistant Professor 0 yes / 2467 other
Texas A&M University 21 $1,293,657 2,141 2,141 99% TXVTWADCVAPANM Assistant Professor; Postdoctoral Research Associate; POSTDOCTORAL RESEARCH ASSOCIATE; ASSISTANT PROFESSOR; Instructional Assistant Professor 0 yes / 2141 other
Massachusetts Institute Of Technology 3 $15,400 2,072 2,072 0% MACANJ Research Scientist; Postdoctoral Associate; Assistant Professor; Lecturer; Research Associate 0 yes / 2072 other
Baylor College Of Medicine 30 $460,739 1,881 1,881 99.8% TXVA Postdoctoral Associate/Fellow; POSTDOCTORAL ASSOCIATE/FELLOW; Assistant Professor; Instructor; Staff Scientist 0 yes / 1881 other
Michigan State University 1 $6,444 1,875 1,875 0.3% MICAMDTXNJWAAZMANYMONCSCPAWY Assistant Professor; Research Associate; RESEARCH ASSOCIATE; ASSISTANT PROFESSOR; Information Technologist III 4 yes / 1871 other
Nagarro Inc 7 $565,614 1,713 1,723 1.8% NYTXNCMAPAUTKSNJFLGAILAZSCWACAINMICTOHMNORCOVAMOVTNH DEVELOPER; SENIOR DEVELOPER; TECHNICAL LEAD; BUSINESS ANALYST; DEVELOPER LEAD 1709 yes / 4 other
Aecom Technical Services Inc 181 $25,496,954 1,691 1,691 14.7% MACANYWAMDTXCOVAPACTNEAZOHTNFLGAILMNMIUTNCHINJLAWISCRIIDIAALKYINNMMODCNVDEORND Civil Engineer; Civil Engineering II; Civil Engineering III; Civil Engineering I; Structural Engineer 2 yes / 1689 other
Ntt Data Americas Inc 14 $818,935 1,651 1,651 31.1% TXPAGAWAMICANCVTAZUTNJKYMANYCOKSFLMNALOKNHTNILOHRIVASCCTDEINMDWINEMOIAOR Software Development Specialist; Software Development Senior Specialist; Digital Engineering Lead Engineer; Software Development Senior Analyst; Software Development Advisor 0 yes / 1651 other
Cbre Inc 2 $6,500 1,566 2,790 51.5% TXNYNJARWACATNMIMDPAGADEMODCILMAAZVANCKSIAORCOOKSCNVMNFLLAMSOHINALNH Senior Software Engineer; Software Engineer; Principal Software Engineer; SENIOR SOFTWARE ENGINEER; SOFTWARE ENGINEER 40 yes / 1526 other
Cornell University 3 $58,538 1,504 1,504 0% NYFLME Postdoctoral Associate; Assistant Professor; Research Associate; Lecturer; Professor 0 yes / 1504 other
Wsp Usa Inc 97 $16,380,693 1,453 1,453 12.3% MANYMDNCNMNVCAKSWAFLTXVANJILORDCPAMIGACOAZINMOUTAKRICTMNKYIDVTALWITNLASCOHME Consultant, Structural Engineer; Structural Engineer; Civil Engineer; Associate Consultant, Structural Engineer; Consultant, Traffic Engineer 0 yes / 1453 other
Motorola Solutions Inc 1 $251,891 1,275 1,275 20.4% NCTXILNYFLTNCAOHMAGAAZUTNJWASCVACOOKRIPAALINMDARMINHMOCT Sr Software Engineer; Software Engineer; Senior Software Engineer; Sr. Software Engineer; Principal Software Engineer 30 yes / 1245 other
University Of Miami 1 $500 1,218 1,218 0% FLCAALKY Assistant Professor of Clinical; Post Doctoral Associate; Assistant Scientist; Assistant Professor; Research Assistant Professor 0 yes / 1218 other
Rbc Capital Markets 1 $73,297 1,027 1,105 1% NYNJMNCATXDENCGAILMIIDPAAZ Associate Director; Senior Electronic Trading Developer; Vice President, Global Investment Banking; Analyst, Global Investment Banking; Associate, Global Investment Banking 1 yes / 1026 other
Jacobs Engineering Group Inc 128 $22,867,767 927 927 21.7% COILFLCAAZGAWITXNJDCUTNCVANYPAOHMOORSCWAMIAKMAINCTTNNVIDMDALNMIANE STRUCTURAL ENGINEER; GEOTECHNICAL ENGINEER; SENIOR AVIATION PLANNER AND TERMINAL DESIGN MANAGER; ELECTRICAL ENGINEER; CIVIL ENGINEERING PROFESSIONAL ASSOCIATE 0 yes / 927 other
Rsm Us Llp 3 $57,630 913 913 12% NYCAWAVAMOILFLTXNCTNOHAZNJINGAPAMAMIDCMDMNDECTIACO Audit Associate; Business Tax Senior Associate; Assurance Manager; Technology Risk Consulting Senior Associate; Corporate Tax Senior Associate 2 yes / 911 other
Texas Tech University 33 $10,265,816 898 898 98.6% TXPAMDNY Assistant Professor; Post Doctoral Research Associate; Postdoctoral Research Associate; Programmer Analyst III; Research Assistant Professor 0 yes / 898 other
Harmony Public Schools 2 $2,134 895 895 100% TX Math Teacher; Science Teacher; Computer Teacher; Foreign Language Teacher; Assistant Principal 2 yes / 893 other
Moody'S Investors Service 2 $33,000 850 1,353 0.9% NCNYNJMACATXCTSC Senior Software Engineer; Software Engineer; Associate Lead Analyst 1; Analyst; AVP-Analyst 0 yes / 850 other
V-Soft Consulting Group Inc 14 $216,452 846 846 20.9% ILKYNJSCRITXDEOHVAORCAIDGANYARMDNCWITNPAMNFLNEIAMAWACOMIAZMOKSINNVCTDCALNDNH Data Engineer; ServiceNow Developer; Programmer Analyst; Computer Programmer; Software Engineer 846 yes / 0 other
Kelly Services Inc 15 $40,897 835 835 3% PAMDMINJARDCAZCTMANCMNTXILVAIAGAFLWACAUTWIOHNYINORCONDRI Scientist; Scientist 12; Senior Software Engineer; Scientist 5; Scientist 14 2 yes / 833 other
Pyramid Consulting Inc 6 $124,227 829 829 4.6% TXFLNJVANCARGAPACTCADEILNHCORINYMDMAOHAZ Application Programmer V; Application Architect V; Data Analyst; IT Project Delivery Manager; Application Programmer III 0 yes / 829 other
Burns & Mcdonnell Engineering Company Inc 27 $5,876,086 786 786 24.3% FLGAMOMATXWINCMICTILNJAZCOWAVASDTNMNNMKSNYPACAMEOR Staff Electrical Engineer; Senior Electrical Engineer; Project Manager; Assistant Construction Manager; Distribution Planning Consultant 0 yes / 786 other
Rocket Mortgage Llc 12 $280,559 761 761 16.8% TXNCMIGAAZNJCAVAMASCWAILPAMDNEOHMNNYKYARFLORALINDEMOTNCTCOLANV Senior Software Engineer; Software Engineer II; Software Engineer; Data Engineer II; Team Leader, Engineering 0 yes / 761 other
Texas A&M Agrilife Research 22 $408,243 715 715 99% TXNJAZWA Postdoctoral Research Associate; POSTDOCTORAL RESEARCH ASSOCIATE; Assistant Research Scientist; Assistant Professor; Research Associate 0 yes / 715 other
California Creative Solutions Inc 14 $220,041 713 713 8.1% CATXPAGAWAVAOHNJMONYINMIKYILALDEORFLCTTNMDCOMAAZMSMNNENCIAOKDCWINV BI Developer; BI Analyst; Systems Engineer; Data Analyst; Data Engineer 713 yes / 0 other
Quest Diagnostics Inc 6 $14,095 711 1,293 4.6% PAVACAKSTXNJGAOHFLNCWANVINMASCUTMI Clinical Laboratory Scientist; Software Engineer III; Clinical Laboratory Scientist II; Software Engineer II; Principal Software Engineer 65 yes / 646 other
Relx Inc 3 $720 711 711 2.4% CANCILFLGANJNYMIVATXOHMNWANHCOCTMASC Software Engineer II; Software Engineer III; Software Engineer I; Senior Software Engineer II; Consulting Software Engineer 6 yes / 705 other
Stantec Consulting Services Inc 104 $11,133,663 703 705 12.5% AZNCCAILTXMNNYPAWACTMDIDTNFLOHGACOMADCMINVORUTVAHINDKYNMLASCKSINNJMEIA Structural Engineer; Civil Designer; Civil Engineer; Civil Engineer in Training; Civil Engineer EIT 0 yes / 703 other
Johnson Controls Inc 1 $5,674 683 812 8.8% FLWIOHTXPATNMIGAKYILMAMNKSNCCAINWANJVAORNVSCCTCONYAZMDDEALNHMOOKVT Senior Software Engineer; Solution Architect; SENIOR SOFTWARE ENGINEER; Package Project Lead 2; Software Engineer 62 yes / 621 other
Washington State University 2 $4,835 667 670 0.7% WACAUTILNJMDTXWVNYCOLA Assistant Professor; Postdoctoral Research Associate; Research Associate; Research Assistant Professor; Teaching Assistant Professor 0 yes / 667 other
Hdr Engineering Inc 189 $24,760,820 666 666 21.3% CAORNVTXWAVAMOMNTNILAZFLNJINCOHIGAMDSCDCMANESDLAOHUTPANHALKYNMIDWV Water/Wastewater Engineer in Training (EIT); Bridge Engineer in Training (EIT); Traffic Engineer; Traffic Engineer in Training (EIT); Bridge Engineer 0 yes / 666 other
Bdo Usa Pc 15 $1,638,718 652 652 8% NYCATXNJILOHMADEPAVACOMOGAWAAZFLCTMDNCMIMNAKKYNV Senior Audit Associate; Senior Tax Associate; Audit Manager; Senior Assurance Associate; Tax Manager 0 yes / 652 other
Environmental Systems Research Institute Inc 1 $3,195 635 635 3.8% MNTXCANCFLWACOVANJGAMDDEORPAINMEMAIL Software Development Engineer; Product Engineer; Support Analyst; Solution Engineer; Business Analyst 0 yes / 635 other
Speridian Technologies Llc 6 $98,648 627 627 5.4% MOTXNCNMMICANYFLKYMDWAGAARVAILUTSCAZKSMAPATNVTHIALNJNE Software Engineer; SOFTWARE ENGINEER; Project Manager; Lead Developer; PROJECT MANAGER 626 yes / 1 other
Indotronix International Corporation 8 $140,537 608 608 20.9% TXARNJNCCAPANYOHFLIAMOTNILAZVAMIWICODEMAWAINMNNHGAKSMD Software Developer; Software Engineer; Java Developer; Test Lead; QA Test Engineer Lead 606 yes / 2 other
Oklahoma State University 2 $1,700 604 604 0% OKWAARVA Assistant Professor; Post-Doctoral Fellow; Associate Professor; Research Assistant Professor; Teaching Assistant Professor 0 yes / 604 other
Corporate Solutions General Inc 6 $125,400 593 593 54.1% TXNCGAFLMICAARUTPANJDEAZOKALOHVACTMNWIMANHTNIAILNYDC Software Developer; Software Engineer; Data Engineer; Software QA Engineer; Salesforce Developer 586 yes / 7 other
The University Of Texas At Austin 76 $579,500 589 589 99.2% TXMSIL Assistant Professor; Postdoctoral Fellow; Research Associate; Research Engineering/Scientist Associate III; Assistant Professor of Instruction 0 yes / 589 other
Lexisnexis Risk Solutions Fl Inc 9 $20,970 569 569 7.2% CAMOTXFLPAOHGANCILVAUTMIRIDEAZNJNYMAMNMDIN Software Engineer III; Senior Software Engineer; Quality Test Engineer III; Manager Software Engineering; Consulting/Principal Software Engineer 0 yes / 569 other
Gainwell Technologies Llc 16 $7,610,251 554 1,002 27.8% WITXFLGAILKSWAMICAVAMOOHNCMEINMDARTNCOSCKYPANYWVNJMSMAOKLANVCT Senior Professional Application Designer; Advisor Application Designer; Senior Professional Programmer Analyst; Senior Professional Product Developer; Professional Programmer Analyst 35 yes / 519 other
Megan Soft Inc 7 $120,494 543 543 10.3% MITXCAILTNNCVAGACTOHMANYORMNFLAZARIN Software Developer; Sr. Software Developer; Systems Engineer; Sr. Systems Engineer; Information Security Analyst 543 yes / 0 other
University Of North Texas 30 $1,107,037 542 542 98.9% TXCA Assistant Professor; Clinical Assistant Professor; Postdoctoral Research Associate; Lecturer; Research Assistant Professor 0 yes / 542 other
Stv Incorporated 55 $10,585,390 538 4,904 9.3% WANYTXILNCPAMDMACTFLGANJTNVACADCSCOK Architectural Designer; Engineering Specialist; Engineering Specialist, Civil; Engineering Specialist, Civil Engineering; Project Controls Specialist 0 yes / 538 other
Gartner Inc 10 $1,371,800 537 537 26.3% VACATXCTFLMDDENYILRIWAPAMA Senior Software Engineer; Manager, Software Engineering; Lead Software Engineer; Software Engineer; Director, Software Engineering 7 yes / 530 other
Concur Technologies Inc 2 $7,670 536 536 18.3% WAPAVAMNTXCAUTFLNYGA Senior Developer; Developer; Development Expert; Development Manager; DevOps Engineer 0 yes / 536 other
Molina Healthcare Inc 5 $52,494 496 984 19.8% CATXAZCONCOHSCILNYNJPAWAFLMIGAKYTNVAWIUTRI Lead Engineer, Applications; Lead Analyst, Healthcare Analytics; Sr. Engineer, Applications; Manager, Healthcare Analytics; Manager, Applications 67 yes / 429 other
Lorhan Corporation Inc 4 $63,750 491 494 18.1% ILNJMOTXCOOHNYCAGAVAFLNCWINHTNORKSAZMNMINVALWAMDUTMSLADERINEPACTMA SOFTWARE DEVELOPER; Software Developer; JAVA DEVELOPER; SOFTWARE ENGINEER; Java Developer 491 yes / 0 other
Agreeya Solutions Inc 23 $780,115 471 477 22.5% VAFLINTNAZGATXCAKYARNJWIOHILPANYORMNCOMINCWAMANH Software Developer; Sr. Software Developer; Software Engineer; Software Test Engineer; Database Administrator 461 yes / 10 other
Signature Commercial Solutions Llc 6 $50,257 460 460 22% TXILMOFLNCVAIACANHNJUTGADEMNSCAZNYOHMA Application Programmer V; Application Architect V; Lead Software Engineer; Application Programmer; Software Engineer 4 0 yes / 460 other
University Of Houston 10 $1,253,804 455 455 99.3% TXIDCA Assistant Professor; Postdoctoral Fellow; Research Assistant Professor; Instructional Assistant Professor; Lecturer 0 yes / 455 other
Ncs Pearson Inc 13 $14,842,294 443 448 16.9% NJMNTXNCIACOAZCAPAMDMAOHUTVAORILGAFLNV Senior Software Developer; Senior Software Engineer; Software Developer; Software Quality Engineer; Engineering Lead 2 yes / 441 other
Gcom Software Llc 3 $6,319,087 443 443 5.6% CANJNYTXMIMDWIVAPAGAFLNCMAKSAZOHTNMO Software Developer; Business Analyst; Application Designer; Project Manager; Technical Architect 301 yes / 142 other
Texas Tech University Health Sciences Center 57 $70,768,816 426 426 99.8% TXFL Assistant Professor (Internal Medicine); Assistant Professor (Pediatrics); ASSISTANT PROFESSOR; HSC Post Doctoral Research Associate; Assistant Professor (Psychiatry) 0 yes / 426 other
Tyler Technologies Inc 16 $375,911 426 430 24.6% OHTXGAPAWAUTMITNKSNCSCORCOAZMEVANYINCAMSNJILFLKYMAARNEDEAL Software Engineer; Senior Software Engineer; Software Developer; Sr. Software Engineer; Lead Software Engineer 0 yes / 426 other
American Unit Inc 17 $372,202 422 422 34.1% OHTXNYVANECAMICONJNCGAFLILTNWYIAARPAMOWADCSCUTAZMAMDMNWIOKKYNV Software Developer; Software Engineer; Tririga Developer; Java Developer; Solution Architect 414 yes / 8 other
Sas Institute Inc 6 $14,600 422 422 1.4% NCSCTXNYVACAGAWAMIUTFLMAILCTCOIN Software Developer; Research Statistician Developer; Senior Software Developer; Principal Software Developer; Senior Solutions Advisor 0 yes / 422 other
Spruce Technology Inc 3 $403,759 396 396 11.6% DENJAZNYTXCAFLPAOHILMDGAARMONEVANCMAMIMN IT Analyst; IT ANALYST; CRM Developer; Software Developer; Business Analyst 396 yes / 0 other
Texas A&M Engineering Experiment Station 4 $129,375 393 393 98.2% TXCAKSMAPA Postdoctoral Researcher; POSTDOCTORAL RESEARCHER; Assistant Research Scientist; Senior Research Engineer I; Postdoctoral Research Associate 0 yes / 393 other
Maximus Inc 8 $114,727,521 389 434 15.7% ILOHMDTXVACANYNJMNPANCGASCDEFLCOAZWIMADCARMILAKS Senior Engineer - Software Engineering; Senior Engineer - Software Quality Assurance; Senior Software Developer; IT Lead Engineer - Software Engineer; IT Lead Engnr - Cloud Ops 14 yes / 375 other
Lancesoft Inc 24 $461,648 387 387 13.7% TXCAWAMNNJFLCONCMIGAWYPAVAMDNYOHNEINMAMOKSNMILCTAZTNALVTUTNDORWINVME Software Developer; Business Analyst; Data Analyst; Sr. Business Analyst; Sr. Data Analyst 2 yes / 385 other
Teksystems Inc 49 $970,142 359 359 8.4% NCMDILMIFLTXNYNMNJSCKYDEORPACAOHINCOMSKSMAWAVA Software Engineer; Developer; DevOps Engineer; Java Developer; Test Automation Lead 4 yes / 355 other
Teksystems 10 $186,187 359 359 8.4% NCMDILMIFLTXNYNMNJSCKYDEORPACAOHINCOMSKSMAWAVA Software Engineer; Developer; DevOps Engineer; Java Developer; Test Automation Lead 4 yes / 355 other
Willis Towers Watson Us Llc 4 $29,381 359 359 3.9% ILMAGANYVACATXPACTCOMNMIWANCOKNJIAOHNVFL Analyst; Lead Associate; Senior Associate; Associate; Associate Director 0 yes / 359 other
Tekgence Inc 6 $85,600 344 344 31.4% TXNCCAKYNYNJPAAZOHWVGAMOMACOFLVAWADCUTTNMIILDEIAMNARMDORCTSCWI Network Engineer; DevOps Engineer; Software Developer; Java Developer; Devops Engineer 340 yes / 4 other
Prophecy Consulting Inc 7 $103,770 342 342 17.5% OHTXMNNJPACANCARAZILGAMIORNYWAUTCOMOTNWVCTVANVFLALIAMDNE Software Developer; Software Development Engineer in Test (SDET); Senior Software Engineer; Software Development Engineer in Test; Data Engineer 340 yes / 2 other
Cvent Inc 1 $1,576 336 337 26.8% TXVANJGAMANYWAUTORCAAZNENCMOKSDCCT Senior Software Engineer; Lead SDET; Lead Software Engineer; Principal SDET; Software Engineer II 48 yes / 288 other
Nationstar Mortgage 8 $112,098 335 374 96.7% TXMIILFLCANC Principal Software Development Engineer; Principal Systems Developer; Sr. Principal Data Services; Sr. Principal Software Developer; Sr. Principal Information Systems 45 yes / 290 other
Topsys It Solutions Llc 3 $38,689 328 328 11.3% GAPANYTXCAMOILOHVANCTNMILAUTINNESCRIFLOKAZMDCTNJMAARORKYIA Software Developer; Salesforce Developer; IT Analyst; Java Developer; Application Developer 297 yes / 31 other
Crowe Llp 1 $48,500 327 327 18% CATXILNYINGAFLNJDCOHMANHMIVAWAMDTNCTWI Audit Associate; Audit Senior Staff; Audit Staff; Financial Crime Testing Manager; Tax Staff 0 yes / 327 other
Parsons Transportation Group Inc 30 $5,246,606 319 319 11% TXNYCAWAVANCPAGANJMDILCTFLMIIDCOINMAORDCNV Engineer, Associate; Engineer II; Engineer I; Associate Engineer; Senior Engineer 0 yes / 319 other
Bdo Usa P C 13 $2,582,153 318 318 10.4% TXMAMSALNYOHILMOCAMDVACONCOKFLNVDCNJWAGAPATNMICTAZ Tax Manager; Senior Assurance Associate; Senior Tax Associate; Assurance Manager; Senior Audit Associate 0 yes / 318 other
Digital Intelligence Systems Llc 11 $117,517 316 316 32.6% TXNCCAVAWANJORGAFLILTNDCMICORIUTMAPANYDEMDAZ Data Analyst; Full Stack Engineer; Software Engineer; Java Developer; Senior Software Engineer 0 yes / 316 other
Rackspace Us Inc 1 $130,000 312 312 72.4% TXILCACOPAMANJFLWAVAKSNCMOOHRIGA Software Developer III; Software Developer IV; Professional Services Delivery Architect, Specialty Domain; Technical Product Manager III; Software Developer II 0 yes / 312 other
Union Pacific Railroad Company 9 $88,269 310 310 0% NECOMOUT Systems Engineer; Associate Systems Engineer; Sr. Project Engineer; Software Engineer; Sr. Lead Software Engineer 57 yes / 253 other
Globalpoint Inc 6 $11,743 307 307 10.1% GANCPATXOHILNJAZORCANYFLVACTMNIAARWACOALUTMO SOFTWARE ENGINEER; SOFTWARE DEVELOPER; SENIOR SOFTWARE ENGINEER; ORACLE EBS DEVELOPER; CPQ DEVELOPER 305 yes / 2 other
Southern Methodist University 1 $1,600 307 307 100% TX Postdoctoral Fellow; Assistant Professor of Finance; Assistant Professor; Research Associate 2 (Particle Physics Electronics Engineer); Assistant Professor of Economics 0 yes / 307 other
Bendix Commercial Vehicle Systems Llc 1 $9,289 306 306 0% OHINMIKYPAILTNNCCA Engineer 2, Controls Vehicle; Product Owner 2; Director, Software Global R&D - Steering; Product Owner; Engineer 2, Product 0 yes / 306 other
I2u Systems Inc 5 $93,200 305 305 22% TXNJWAAZPAVAMDNYCANCILGAOHFLORMICOKSRICTMAMNARKYTN DevOps Engineer; Software Engineer; RPA Developer; Data Engineer; Hadoop Developer 277 yes / 28 other
Hntb Corporation 117 $51,852,271 304 304 4.9% FLCAINGAPANYNJTNWAMIOHTXCTVAILMADCMDMONCLA Engineer III; Engineer II; Project Engineer; Project Manager II - Engineering; Engineer I 0 yes / 304 other
Texas State University 60 $2,045,859 303 303 100% TX Assistant Professor; Lecturer; Postdoctoral Scholar; Program Faculty; Assistant Professor of Instruction 0 yes / 303 other
Bny Mellon 4 $508,362 296 296 2.4% NYFLNJPATXIL Software Developer; JAVA DEVELOPER; Software Engineer; SOFTWARE DEVELOPER; Computer Systems Analyst 248 yes / 48 other
Computer Aid Inc 6 $2,460,648 294 294 1% PANJILDEVAGAFLTXNCKSSCNYINCADCMI Software Developer; Sr. Software Developer; Programmer/Analyst; Software Architect; Database Administrator 8 yes / 286 other
Cynosure Technologies Llc 50 $994,167 291 291 50.5% FLTXNYGATNILAZNJWAMNMOPANCCAALCTMINVIACOVAOHSCMARIMD Software Developer; Software Engineer; Sr. Software Developer; Software Project Manager; Software Engineer 291 yes / 0 other
Hellmuth Obata & Kassabaum Inc 13 $421,176 290 290 7.2% WACANYTXILMOMAPAFLDCGA Designer; Design Professional; Senior Design Professional; Senior Designer; Architect 0 yes / 290 other
Prelude Systems Inc 55 $736,899 286 286 7% CATXCTINMOFLGAIDOHILVAMIMDTNMNORNC Programmer Analyst; Software Developer; Computer and Information Systems Manager; Salesforce Analyst; Operations Research Analyst 285 yes / 1 other
General Dynamics Information Technology Inc 5 $2,434,588 285 285 8.1% GANCNYMDVAKSWATXFLMODEMNILSCNJARCATNIAMAPA Software Developer; SOFTWARE DEVELOPER; Appian Developer; Software Developer Senior; Software Developer Advisor 33 yes / 252 other
Guidehouse Inc 26 $2,073,694 284 284 2.1% MDNYVAMAPATXCOGAILNJCADCORWA Senior Consultant; Managing Consultant; Director; Consultant; Senior Associate 0 yes / 284 other
Terracon Consultants 71 $1,830,323 280 280 27.1% TXNCILPACAGAOHMAVAIANMNJKSFLAZMONYWANDMIORCOOKNHMDKYINMNSCTN Staff Engineer; Senior Staff Engineer; Field Engineer; Project Engineer; ERP Applications Developer III 0 yes / 280 other
Terracon Consultants Inc 10 $804,396 280 280 27.1% TXNCILPACAGAOHMAVAIANMNJKSFLAZMONYWANDMIORCOOKNHMDKYINMNSCTN Staff Engineer; Senior Staff Engineer; Field Engineer; Project Engineer; ERP Applications Developer III 0 yes / 280 other
Michael Baker International Inc 28 $2,156,134 274 274 15.7% ILLACATXMINYVAKSCOFLWIMANJMDUTCTARMNOHAZKYPAINWVSCNC Civil Engineer I; Civil Associate I; Civil Associate II; Civil Engineer II; CIVIL ASSOCIATE II 0 yes / 274 other
Health Management Systems Inc 27 $5,611,828 269 269 86.6% TXGAWAPANJNCTNCOVAMOARNHOHCAMANENV Advisor Application Designer; Senior Professional Application Designer; Developer Senior Analyst; Professional Application Developer; Senior Professional Product Developer 0 yes / 269 other
Amzur Technologies Inc 18 $327,344 262 262 22.5% COMOFLGATXNYNJNCILMAVATNMDKYCAPANVMNDECTME PL/SQL Developer; Java Architect; Software Developer; Salesforce Developer; ETL INFORMATICA DEVELOPER 246 yes / 16 other
Mobile Programming Llc 6 $98,858 261 261 4.2% FLNYCATXNJAZPAMINCORINILARMOWI Software Developer II; Software Developer; Business Analyst; Quality Analyst; Quality Engineer 261 yes / 0 other
Xtglobal Inc 2 $433,307 255 255 40.8% TXDCIAGANCRINJILPANYOHVAUTFLMNCAMAWAINMIKY SENIOR SOFTWARE TEST ENGINEER; SOLUTION ARCHITECT; SOFTWARE ARCHITECT; DEVOPS AUTOMATION ENGINEER; SQL DATABASE ADMINISTRATOR II 254 yes / 1 other
Jpmorgan Chase Bank 4 $161,264 250 331 27.2% NJDETXFLOHILNY Software Engineer; Test Engineer; Software Programmer II; Software Developer; SENIOR BUSINESS ANALYST 232 yes / 18 other
Devcare Solutions Ltd Co 1 $23,760 249 249 10.4% OHMIIANCVANEDEMDPAMOTXTNNYCANJDCKYMNRIFLINUTIL SOFTWARE DEVELOPER; COMPUTER SYSTEMS ENGINEER; PROJECT MANAGER; DATA ANALYST; SOFTWARE (CRM) DEVELOPER/SPECIALIST 249 yes / 0 other
University Of Texas At San Antonio 4 $4,918 246 247 100% TX Assistant Professor; Postdoctoral Fellow; Assistant Professor of Instruction; Special Research Associate; Assistant Professor of Practice 0 yes / 246 other
Data Systems Integration Group Inc 32 $390,963 245 245 7.8% OHNCCTTXILWAINPAMDFLGAAZVAMODCNMNJNYMICA SOFTWARE DEVELOPER; Software Developer; Software Developers, Applications; INTEGRATION DEVELOPER; MDM Developer (Software Developer) 245 yes / 0 other
Alrek Business Solutions Inc 17 $168,830 241 241 14.9% MIILINMNGANYTXPAKSMDCTARNVNEAZORLANCOHKYCAWIWAIDMTVTNJ Software Developer; Business Analyst; Application Developer; Senior SQL Server Database Administrator; Dot Net Developer 235 yes / 6 other
Wsp Usa Buildings Inc 3 $2,839 239 239 14.2% NYCATXNJMAVAMIAZGAMOINILFLWIWACONCDCPAMD Associate Consultant, Structural Engineer; Associate Consultant, Mechanical Engineer; Associate Consultant, Electrical Engineer; Associate Consultant, Built Ecology; Structural Engineer 0 yes / 239 other
Atos It Solutions And Services Inc 1 $5,802 237 237 27% TNAZORWINVNCPAOHTXFLNYNJCAILCTMONDARVAMNCOWAMIMD Project Manager; Senior Software Engineer; DWP Solution Architect; Senior Network Engineer; Network Engineer 38 yes / 199 other
Texas A&M University - Corpus Christi 4 $344,201 235 243 99.6% TXNY Assistant Professor; Postdoctoral Research Associate; Assistant Professor Marine Biology; Software Applications Developer III; Professional Assistant Professor Computing Sciences 0 yes / 235 other
Texas A&M University-Corpus Christi 18 $58,214 235 243 99.6% TXNY Assistant Professor; Postdoctoral Research Associate; Assistant Professor Marine Biology; Software Applications Developer III; Professional Assistant Professor Computing Sciences 0 yes / 235 other
Atkins North America Inc 21 $669,305 225 225 20.4% FLGASCNJCONYTXNVILPACAORMIVAKSMDWINCAZMO Engineer II; Senior Engineer I; Engineer I; Senior Cost Manager; Senior Project Manager 7 yes / 218 other
Gannett Fleming Inc 6 $3,874,946 222 222 5.9% TXNHCAWAILOHNCMDDCPAMANJAZIAVAMICTFLNY Designer, Power; Designer, Architecture; Office Engineer; Staff Engineer, Geotechnical Dams & Hydraulics; Associate Designer, Water 0 yes / 222 other
Cdm Smith Inc 40 $3,296,945 221 221 35.7% OHCOTXMAAZMNVACAFLNCCTILNHTNNMNYMOGAWAINPANJ Transportation Engineer 4; Transportation Planner 3; Transportation Engineer 3; Environmental Engineer 3; Environmental Engineer 2 0 yes / 221 other
Datson360 Llc 26 $310,755 212 218 14.6% ILDETXRIWANCFLSCMDMAGACATNMICOOHNYARKSNHVAMOWIPANVNJOKNEMN Software Systems Engineer; IT Project Manager; Business Analyst; Systems Engineer; Software Developer 146 yes / 66 other
Coursera Inc 6 $6,384 211 211 5.2% WACATXNVNJDCVAGANY Software Engineer; Senior Software Engineer; Senior Product Manager; Data Engineer; Data Scientist 7 yes / 204 other
Milliman Inc 14 $670,856 209 209 3.3% WIILCAWACTNYPATXGAFLNJ Actuarial Analyst; Associate Actuary; Consulting Actuary; Financial Quantitative Analyst; Data Engineer 2 yes / 207 other
Walter P Moore And Associates Inc 10 $271,319 207 207 50.2% TXNYCAFLILDCCOGAMOKSNVNCMI Graduate Engineer- Structures; Graduate Engineer - Diagnostics; Graduate Engineer - Structures; Graduate Engineer - Water Resources; Engineer 0 yes / 207 other
Bnsf Railway Company 1 $287 207 257 90.8% TXNJWAKSCAFLGAMOIL Architect; Software Engineer; Technology Consultant 2; Software Systems Engineer; Lead Consultant - 2 - US 132 yes / 75 other
Hdr Architecture Inc 14 $1,543,846 204 204 7.8% TXWAMACAILGAVAMNAZMONENJNCHIPA Design Coordinator 2; Design Coordinator; Senior Design Coordinator; Project Architect; Architect 0 yes / 204 other
University Of Texas At Arlington 72 $3,199,853 202 202 99.5% TXGA Assistant Professor; Assistant Professor of Research; Research Scientist I; Assistant Professor of Instruction; Post Doctoral Fellow 0 yes / 202 other
Hks Inc 8 $1,387,680 199 199 39.2% CAILTXDCGAUTNYFLNCMIMACOVAAZ Design Professional - Architecture; Design Professional I - Architecture; Job Captain; Designer; Design Professional II - Architecture 1 yes / 198 other
Corgan Associates Inc 1 $2,725 197 197 43.1% CANYTXILFLWAAZGA Designer; Project Coordinator; Project Specialist (Architect); Project Specialist; Project Lead 0 yes / 197 other
Mercer (Us) Llc 2 $26,000 196 196 7.1% GANYKYTXWAILCANJUTCTDCVAFL Employee Experience COE Consultant; Senior IT Implementation Consultant II; Senior Talent Strategy Consultant I; Workforce Strategy Consultant; Workforce Strategy & Analytics Consultant - Senior Analyst 5 yes / 191 other
Mercer Us Llc 3 $25,113 196 196 7.1% GANYKYTXWAILCANJUTCTDCVAFL Employee Experience COE Consultant; Senior IT Implementation Consultant II; Senior Talent Strategy Consultant I; Workforce Strategy Consultant; Workforce Strategy & Analytics Consultant - Senior Analyst 5 yes / 191 other
Taproot Solutions Inc 23 $709,004 195 195 34.9% CATXNCILOHFLGAVAMDWINJAZNYPAKSMOINCOMNMIUT Software Developer; Software Developer (Pega Developer); Pega Developer (Software Developer); Software Developer (Functional Area Expert II); SOFTWARE DEVELOPER 195 yes / 0 other
Kleinfelder Inc 13 $36,136 194 434 10.8% TXAZMACAOHOKPAWAMDGANCNJVAUTNVCONYCT Staff Professional I; Professional; Staff Professional II; Project Professional; STAFF PROFESSIONAL I 0 yes / 194 other
Southwest Research Institute 14 $571,149 193 193 85% TXCOMI Research Engineer; Senior Research Engineer; Research Scientist; Senior Research Scientist; Engineer 0 yes / 193 other
American Institutes For Research 1 $27,867 191 191 5.2% WATXNJMAVALAILCAMDPADCGATNHINCWIIN Researcher; Senior Researcher; Senior Economist; Research Associate; RESEARCHER 0 yes / 191 other
Judge Technical Services Inc 11 $91,561 190 190 19.5% PANCOHVATXCOILARCADENJFLMOAZMSGADCMIMNMA SENIOR SOFTWARE ENGINEER; DATA SCIENTIST; SPECIALTY SOFTWARE ENGINEER; Senior Software Engineer; SOFTWARE DEVELOPER 1 yes / 189 other
Texas A&M Transportation Institute 102 $8,838,315 186 186 98.4% TXMSNH Assistant Research Scientist; TTI Assistant Research Scientist; Associate Transportation Researcher; ASSISTANT RESEARCH SCIENTIST; TTI ASSISTANT RESEARCH SCIENTIST 0 yes / 186 other
Zirlen Technologies Incorporated 4 $77,611 184 184 60.3% MNTXTNGANJNEDCILOHMICAFLNYAZCTORVASCNDIN Software Developer; SOFTWARE DEVELOPER; Systems Engineer; ServiceNow Developer; Data Engineer 178 yes / 6 other
Republic Services Inc 3 $321 181 181 2.8% TXAZPANCOHGAINMACTNYCA ETL Developer III; Analytics Engineer II; Senior Business Analyst; Senior Application Programmer/Analyst Developer; SENIOR ISERIES DEVELOPER 30 yes / 151 other
Cohnreznick Llp 22 $6,552,636 177 177 4.5% MDCATXGAMANYVAILNJNCFL Assurance Senior Associate; Senior Consultant; Associate; Audit Associate; Assurance Manager 0 yes / 177 other
Texas A&M Health Science Center 8 $175,171 174 174 100% TX POSTDOCTORAL RESEARCH ASSOCIATE; ASSISTANT RESEARCH SCIENTIST; Postdoctoral Research Associate; Senior Research Associate; Assistant Research Scientist 0 yes / 174 other
Fei Com Inc 6 $416,362 171 171 0.6% MDNCGATXMSOHVAOR Application Developer; Systems Analyst; Software Developer; Quality Assurance Analyst; Scrum Master 163 yes / 8 other
Ellucian Company L P 1 $49,500 169 169 16.6% FLPAVAMSTXNYNCARCATNNJNHWIOHGAINMDDE Senior Cloud Application Administrator; Senior Consultant; Senior Cloud Engineer; Cloud Engineer; Business Intelligence Analyst 0 yes / 169 other
Us Bank National Association 48 $46,019 162 347 25.9% MNOHDEGATXWINCWAORIL Technical Lead L1; Cyber Security Analyst L4; Application Architect L1; Techno Functional Consultant L1; Developer L4 162 yes / 0 other
The University Of Texas Rio Grande Valley 5 $148,706 157 157 100% TX Assistant Professor; HR Training Coordinator; ASSISTANT PROFESSOR; ASSISTANT DIRECTOR OF TECHNOLOGY COMMERCIALIZATION; Postdoctoral Fellow 0 yes / 157 other
Vertafore Inc 2 $32 157 159 1.3% FLCOCTMITXGACAILSDNC Technical Consultant II; Software Engineer II; Sr. Technical Consultant; Sr. Software Engineer; Senior Software Engineer 0 yes / 157 other
University Of Texas At Dallas 4 $157,503 155 155 96.1% TXNY Assistant Professor; Research Associate; Assistant Professor of Instruction; Research Scientist; Regulatory Support Associate 0 yes / 155 other
Cannon Design Inc 6 $3,324,479 152 152 4.6% NCMOCAMAWANYVAMDILPATXCOGA ARCHITECTURAL DESIGNER; ARCHITECT (PATH TO LICENSURE); DESIGNER - ARCHITECTURAL (PATH TO LICENSURE); ARCHITECTURAL DESIGNER (PATH TO LICENSURE); Designer IA - Architectural (Path to Licensure) 0 yes / 152 other
Smart Information Management Systems Inc 4 $57,495 151 159 7.9% PATXNJLAWICAMAMNWAGAILAZCODCMISCTNIANYNC Systems Analyst; Software Developer; PEGA Developer; Network Administrator; Technical Consultant 151 yes / 0 other
Xerox Corporation 1 $1,588 151 167 15.2% NYCTNCTXCAVTWANJIN Architect; Security Architect; Analyst II, IM Security; Web Application Developer; Engineer, Single Sign-On 68 yes / 83 other
Bentley Systems Incorporated 1 $975,878 147 147 7.5% MAPACAORFLWAVAALTXMNILOHGAINCTNYNCTNSCLAND Software Engineer II; Associate Software Engineer; Software Engineer I; Senior Software Engineer; Integration Engineer II 0 yes / 147 other
Eclat Solutions Llc 13 $272,192 147 147 38.1% TXVAAZKYNCMOILNHMACOTNGANJMNCAMDFLORDCIN Software Developer; Software Developer (Pega Developer); Software Developer (.NET Developer); Pega Developer (Software Developer); Software Quality Assurance Engineer 133 yes / 14 other
Cogent Infotech Corporation 13 $962,387 144 144 18.8% MATXNYGAAZNCPACTNJMOILFLOHINCAMNMDARORNEVARI Programmer Analyst; Software Developer; SOFTWARE DEVELOPER; PROGRAMMER ANALYST; Systems Engineer 131 yes / 13 other
22nd Century Technologies Inc 52 $891,791 144 144 9.7% TXAZVACALAMIMDKSMOCOFLOHALNYDC Software Developer; Business Analyst; Programmer Analyst; Solutions Architect; Vice President, Business Development 0 yes / 144 other
Cambium Assessment Inc 4 $22,639,008 142 142 0.7% VAPAMDALDCWAGANJMICATXIL Psychometrician; Lead Software Engineer I - CAI; Senior Software QA Analyst; Senior Software Engineer II; Software Engineer II 0 yes / 142 other
Eight Eleven Group Llc 31 $381,373 134 134 15.7% INAZNCCOTNWITXNJOHUTALMIPAVAWAMOGAKYMAMNCAFL DevOps Engineer; Software Engineer; Project Manager; Sr. Axiom Developer; Now Developer 0 yes / 134 other
Acadian Ambulance Service Inc 3 $8,990 134 134 19.4% MSTXLAMOTN Emergency Medical Technician - Paramedic (Degree); Emergency Medical Technician - Paramedic; Critical Care Paramedic 0 yes / 134 other
Ahead Inc 1 $4,728 134 134 24.6% COTXUTMINJMATNCAILINNYNCAZNHPAGAWAMDHIFLVA Technical Consultant; Senior Technical Consultant; Sr. Technical Consultant; Senior Consultant; Principle Technical Consultant 0 yes / 134 other
Sam Houston State University 10 $707,818 129 135 97.7% TXNYCA Assistant Professor; Assistant Professor of Mathematics; Programmer Analyst III; Assistant Professor of Computer Science; Assistant Professor of Finance 0 yes / 129 other
Texas Children'S Hospital 7 $36,540 127 127 96.9% TXNJGA Pathology Quality Assurance Coordinator; Senior Interface Programmer/Systems Analyst; Diabetes Education Specialist II; Oracle HCM Integration Specialist; CDE Fellow 0 yes / 127 other
The University Of Texas At Arlington 24 $2,548,315 126 131 98.4% TXIL Assistant Professor; Postdoctoral Research Associate; Assistant Professor of Research; Business Analytics Analyst III; Research Scientist 0 yes / 126 other
Mayer Brown Llp 10 $106,035 126 149 0.8% NYDCILVACANCTXCT Associate Attorney; Associate; Staff Attorney; Document Management Application Engineer; Power Platform Specialist & Developer 0 yes / 126 other
Rummel Klepper & Kahl Llp 27 $317,793 124 124 3.2% TXFLVAMDSCNCDCPATNUT Engineer; Project Engineer I; Engineer II; Engineer I; Associate Engineer 0 yes / 124 other
Cambridge Systematics Inc 9 $108,399 123 123 13% FLINTXCAGAMNNJNYMAILCOMDWI Transportation Analyst; Travel Demand Modeler; Data Analyst; Travel Demand Modeler, Jr.; Product Designer 0 yes / 123 other
Steck Systems Inc 93 $2,783,734 122 122 43.4% TXMNDCCANCVAFLIAMIPAMAAZILGACONY Software Developer; Business Analyst; Business Intelligence Developer; Front End UI Developer; Automated QA Engineer 115 yes / 7 other
M Arthur Gensler Jr & Associates Inc 3 $21,503 122 122 10.7% CATXNCMDNVAZNYMIWAILDCFLPACOMAGA Technical Designer; Architect; Designer; Job Captain; Design Manager 0 yes / 122 other
Trc Environmental Corporation 29 $422,154 119 119 10.9% TXNJNYCASCWAMAMIMDNMLAGAUTPANCFLORRIMEOH Project Engineer IV; Commissioning Engineer; Transmission Engineer I; Systems Integrator Engineer; Environmental Specialist 0 yes / 119 other
Texas A&M International University 19 $406,132 118 118 100% TX Assistant Professor; ASSISTANT PROFESSOR; Associate Professor; ASSISTANT PROFESSIONAL; Visiting Assistant Professor 0 yes / 118 other
Dla Piper Llp (Us) 12 $967,318 115 115 8.7% FLCADCNYTXDEVAGANJWAIL Associate; Law Clerk; Of Counsel; Attorney; Partner 0 yes / 115 other
Walter P Moore & Associates Inc 16 $439,236 115 115 37.4% CATXNJNYDCFLMANVGAILNCCOMOMD Graduate Engineer II - Structures; Graduate Engineer - Structures; Graduate Engineer I - Structures; Graduate Engineer - Diagnostics; Design Manager 0 yes / 115 other
Forrester Research Inc 4 $49,835 115 115 5.2% MAGANYWITXMDCADCNCFLWAMIMNNH Technical Architect; Principal Analyst; Analyst; Salesforce Developer; DevOps Engineer II 0 yes / 115 other
Stantec Architecture Inc 8 $2,305,275 114 114 14.9% COCAILPADCFLTXVAMAAZINMIOH Designer; Architectural Designer; Interior Design Coordinator; Design Coordinator; Design Coordinator 1 0 yes / 114 other
Resourcesoft Inc 13 $189,050 113 113 0.9% GANCNJNYCTPATXMAILRINHOKFL Software Developer; Technical Recruiter; BI SQL Server Developer; Front End Developer; Quality Assurance Analyst 90 yes / 23 other
Tarleton State University 3 $2,462 111 111 100% TX Assistant Professor; ASSISTANT PROFESSOR; Associate Professor; Instructor; PROFESSOR 0 yes / 111 other
Consor Engineers Llc 65 $7,886,221 109 113 71.6% TXUTORNVFLCACOMDWAAZSC Project Engineer; Engineer in Training; Engineer-in-Training; Design Engineer; Engineering Designer 0 yes / 109 other
Scott & White Clinic 2 $538 109 109 100% TX Internal Medicine Physician; Physical Therapist I; Neurologist; Pediatric Hospitalist; Pediatrician 0 yes / 109 other
Memorial Hermann Health System 1 $409 106 106 99.1% TXGA Assistant Professor; Fellow; Physician, Hospital Medicine; Clinical Data Scientist; Senior Data Analyst 0 yes / 106 other
Texas Health And Human Services Commission 2 $250,000 105 107 100% TX Psychiatrist III; Business Analyst; Software Developer; Mental Health Specialist V; Full Stack Developer 37 yes / 68 other
Cogent Data Solutions Llc 30 $449,645 103 103 7.8% ORTXMIFLCAWINCILKSPACTGAMAMNSCNY Software Developer; Human Resource Manager; Business Intelligence Analyst; Operations / Resource Manager; Systems Analyst 103 yes / 0 other
Schindler Elevator Corporation 1 $749 100 100 0% NJPACTOHFLCAMDMANYDC Electrical Engineer; Senior Engineer; Mechanical Engineer; Associate Finance Manager; Senior Associate JC60 - Mechanical Engineers 8 yes / 92 other
Lamar University 2 $105,535 99 99 100% TX Assistant Professor; Instructor; Database Administrator; Psychology Instructor; Lead Network Engineer 0 yes / 99 other
Westwood Professional Services Inc 29 $2,014,912 98 98 24.5% NVNCWITXMNCOPAFLCAOHGA Graduate Engineer; Electrical Project Engineer; Electrical Graduate Engineer; Lead Substation Engineer - P&C; Transportation Engineer 0 yes / 98 other
Texas A&M University - Kingsville 7 $483,292 98 98 94.9% TXMD Assistant Professor; ASSISTANT PROFESSOR; Lecturer I; Research Scientist; RESEARCH ASSOCIATE 0 yes / 98 other
Texas A&M University -Kingsville 26 $287,522 98 98 94.9% TXMD Assistant Professor; ASSISTANT PROFESSOR; Lecturer I; Research Scientist; RESEARCH ASSOCIATE 0 yes / 98 other
Modjeski And Masters Inc 3 $122,030 98 98 8.2% LAPACOILMINCTXFLDCWVVAMONY Engineer I; Engineer II; Engineer in Training II; Engineer in Training, E2; Engineer in Training I 0 yes / 98 other
Esolvit Inc 79 $1,420,206 97 97 81.4% TXCANCDEMDPANJMO Software Developers, Applications; Business Intelligence Analysts; Computer Programmers; Computer Systems Analyst; Network and Computer Systems Administrators 77 yes / 20 other
3core Systems Inc 1 $3,808 97 97 37.1% FLNJTXGAPAAZILORTNNYNVINMD Software Developer; Network Engineer; Systems Analyst/ Engineer; Senior Software Developer; Senior Software Engineer 87 yes / 10 other
Baylor Scott & White Health 5 $15,765 96 96 92.7% TXFLNYNCIN Analytics Developer II; Mobile Developer; Analytics Developer III; Software Engineer; Sr. Software Developer 18 yes / 78 other
Irhythm Technologies Inc 1 $67 96 96 0% CAWA Senior Software Engineer; Senior Site Reliability Engineer; Senior Regulatory Affairs Specialist; Senior Software Engineer II; Staff Systems Engineer 0 yes / 96 other
Resource Integrators Llc 107 $4,407,672 93 93 77.4% TXCTWAINGACAVANJMOMIIL SOFTWARE ENGINEER; SOFTWARE DEVELOPER; DATA ENGINEER; Software Developer; MACHINE LEARNING ENGINEER 41 yes / 52 other
Stellar Services Inc 11 $629,356 92 92 0% NYGACA Programmer; Data Analyst; Technology Lead; Software Developer; PMIS Manager 87 yes / 5 other
Infojini Inc 74 $1,564,265 91 91 16.5% NCMDTXNYILSCNJDC Curam Developer; SOFTWARE DEVELOPER; Kafka Engineer; INFORMATION TECHNOLOGY PROJECT MANAGER; SHAREPOINT DEVELOPER 46 yes / 45 other
Tetra Tech Inc 10 $928,588 89 89 21.3% GAMICATXMANYPACORIORUTVANCDEFLWAIL Structural Engineer; Civil Engineer; Environmental Engineer; Civil Water/Wastewater Engineer; Water/Wastewater Engineer 0 yes / 89 other
Transystems Corporation 29 $4,916,177 87 87 12.6% PAMDCAFLMAKSTXCTMOILSCOHNYGA Civil Engineer 1; Civil Engineer 2; Civil Engineer I; Structural Engineer 1; Structural Engineer I 0 yes / 87 other
Cambay Consulting Llc 18 $223,124 87 87 35.6% NYNJFLCTMATXMDGAVAILOHWANCPAMNKSORCO Network Security Engineer; Systems Engineer; Data Engineer; Information Security Analyst; DevOps Engineer - (Cloud/Data/SRE) 61 yes / 26 other
Baylor Research Institute 6 $24,941 86 86 100% TX Post-Doctoral Research Fellow; Biostatistician I; Research Associate I; Clinical Research Supervisor; Research Associate 0 yes / 86 other
Bates White Llc 2 $184,880 85 114 0% DCNY Economist; ECONOMIST; Senior Economist; SENIOR ECONOMIST; Managing Economist 0 yes / 85 other
Greenberg Traurig Llp 8 $119,591 85 85 2.4% PANYILNJCAMAVACOTXMNDC Associate; Foreign Law Clerk; Law Clerk/JD; Patent Litigation Asociate; Shareholder IP Prosecution 0 yes / 85 other
Trc Engineers Inc 2 $29,231 85 85 10.6% TXNHNCPACTLAVACAILNYMDMEOHMIINMA Commissioning Engineer; Substation Engineer II; Electrical Engineer III; Associate Supervisor, Substation Engineering; Senior Substation Engineer 0 yes / 85 other
Atkinsrealis Usa Inc 100 $15,474,772 83 83 19.3% TXNJNCMANYGAWIORNVCAMEFLMIAZ Engineer II; Senior Engineer I; Project Manager; Senior Engineer II; Sr Engineer I 0 yes / 83 other
Bowman Consulting Group Ltd 5 $468,843 83 85 18.1% AZPATXVAFLRIMOCANJ Civil Engineer I; Civil Engineer II; Assistant Project Manager, Civil; Project Engineer; Engineer I, Transportation 0 yes / 83 other
Orrick Herrington & Sutcliffe Llp 14 $372,381 83 83 8.4% NYTXCADCWAGAMA Managing Associate; Associate; Law Clerk; Senior Associate; Managing Associate 6190.44 0 yes / 83 other
Ellucian Company Lp 4 $2,970 83 83 20.5% GAARNCTXCAFLNJVAMDOHPANYMATNAZIL Senior Cloud Engineer; Senior Data Engineer; Software Engineer I; Senior Cloud Application Administrator; Software Engineer II 0 yes / 83 other
Texas Health Physicians Group 6 $1,514 82 82 100% TX Hospitalist Physician; Data Research Analyst; Primary Care Physician 0 yes / 82 other
The University Of Texas At San Antonio 14 $104,456 81 81 100% TX Assistant Professor; Assistant Professor of Instruction; Professor of Instruction; Postdoctoral Fellow; Senior Lecturer 0 yes / 81 other
West Publishing Corporation 2 $57,964 81 81 0% MNNYMAPAVADC Senior Software Engineer; Lead Software Engineer; Associate Architect PCT; Systems Engineer; Technical Lead 3 yes / 78 other
Project Management Institute Inc 5 $1,047 79 79 2.5% GANJKSPAINMOTNCANYTXWAORNC Application Developer II; Application Developer; Application Developer III; QA Automation Engineer III; QA Automation Engineer II 3 yes / 76 other
Project Management Institute 1 $372 79 79 2.5% GANJKSPAINMOTNCANYTXWAORNC Application Developer II; Application Developer; Application Developer III; QA Automation Engineer III; QA Automation Engineer II 3 yes / 76 other
Texas Health Resources 10 $4,490 78 78 100% TX Data Integration Engineer II; Sr. Data Integration Engineer; Predictive and Inferential Analyst; Sr. PeopleSoft Technical Developer; Data Integration Quality Assurance Engineer 0 yes / 78 other
Norton Rose Fulbright Us Llp 13 $260,102 77 77 13% CANYDCILTXNJMN ASSOCIATE; LAWYER; Global Chief Strategic Alignment, Innov. & People Officer; COUNSEL; SENIOR ASSOCIATE 0 yes / 77 other
Accela Inc 1 $400 77 95 10.4% NCCATXWAUTMA Sr. Software Engineer; Operations Research Analyst (People Analytics & Technology); Software Engineer; Lead Database Engineer; Software Technical Lead 2 yes / 75 other
Fastenal Company 1 $104 76 76 0% MNNCMIOH Technical Program Analyst; DATA INTEGRATION ENGINEER; IT DATABASE ADMINISTRATOR; Senior Developer; IT Manager 3 yes / 73 other
Ernst & Young Llp 5 $866,872 75 75 2.7% GANJTXOH Computer Programmer; Technical Architect; Senior Technical Architect; Systems Analyst; Computer System Analyst 66 yes / 9 other
Imeg Consultants Corp 4 $7,337 75 75 12% CANYMIMATXNCMTVAAZIDFLILSD Project Engineer I; Civil Engineering Graduate- Designer 2; Structural Engineering Graduate - Designer 2; Plumbing Project Designer; Mechanical Engineering Graduate - Designer I 0 yes / 75 other
Fugro Usa Land Inc 15 $666,382 74 74 51.4% CAFLTX Staff Engineer; Staff Professional; GIS Analyst; Project Engineer; Project Professional 0 yes / 74 other
Computer Task Group Inc 5 $72,121 74 74 47.3% TXNYFLNCCAWANJALARILVA Lead Developer; Computer System Architect; Associate Architect; System Advisor; Software Developer, Applications 0 yes / 74 other
Gft Infrastructure Inc 41 $3,442,981 73 73 19.2% OHCAILNCPAVATXFLDCNJGAMDMAMOAZMIKYSC Designer, Power; Designer, Highway; Designer, Transportation Operations; Designer, Architecture; Sr. Designer, Highway 0 yes / 73 other
Baker Tilly Advisory Group Lp 1 $194,121 71 71 14.1% CAILTXPAVAGAOHNYFLMNWI Senior Tax Associate; Senior Audit Associate; Tax Associate; Tax Manager; Consulting Manager, DCA 0 yes / 71 other
Texas Christian University 1 $1,400 71 71 100% TX Assistant Professor; Hall Director; Area Coordinator; Assistant Professor of Finance; Instructor of English 0 yes / 71 other
Conquest Consulting Llc 102 $2,427,493 70 70 78.6% TXMIVANECAMN Data Engineer; Software Developer; Senior Business Intelligence Analyst/Developer; Database Developer; Software Engineer 15 yes / 55 other
Mgt Impact Solutions Llc 10 $1,865,996 70 70 35.7% NCCAKSGATXFLMNALNJVA Network Engineer; Lead Security Engineer; IT Business Analyst; Senior Network Engineer; Senior Network Security Engineer 3 yes / 67 other
Nec Corporation Of America 7 $1,105,074 70 70 24.3% CANJTXILNC SR. SYSTEMS ENGINEER; Software Architect; Sr. Software Development Engineer; Application Engineer; SALES ENGINEER 2 yes / 68 other
Texas A&M Agrilife Extension Service 8 $301,126 70 70 100% TX ASSISTANT PROFESSOR AND EXTENSION SPECIALIST; Assistant Professor and Extension Specialist; Assistant Professor & Extension Specialist; Postdoctoral Extension Associate; Postdoctoral Research Associate 0 yes / 70 other
Gei Consultants Inc 1 $10,744 69 69 8.7% TXMACANYILMIFLMEWI Civil Engineer; Transportation Engineer; Senior Hydraulic Structures Engineer; Geostructural Engineer; Geotechnical Project Professional 0 yes / 69 other
Bank Of New York Mellon 2 $19,950 68 68 0% PANYNJFLTN QA Automation Engineer; Senior Application Developer; Software Developer; Senior Associate JC60 -Computer Systems Engineers/Architects; Senior Specialist - Software Engineering 39 yes / 29 other
Hyland Software Inc 4 $42,841 67 70 7.5% OHTXNCFLGAMICAILAZVA Developer; Solution Developer 3; Developer III; Developer 4; Solution Consultant 0 yes / 67 other
T Y Lin International 10 $404,415 66 66 1.5% MAILTXWAFLCAAZNYNVVADEDCNJMEPAMI Bridge Designer; Engineer; Project Engineer; Bridge Engineer; Civil Engineer 0 yes / 66 other
Convergeone Inc 4 $54,424 66 66 40.9% TXNJMNUTGANCCAMOCOILFL Solutions Architect; Solutions Architect (Salesforce); Contact Center Solutions Specialist; Advanced Diagnostic Engineer; Security Principal Engineer 0 yes / 66 other
Meridianlink Inc 6 $150,240 64 64 9.4% TXWAVAMAMIPANYCANJKSGALAFL Software Engineer; Senior Software Engineer; Principal Data Engineer; Associate Manager, Software Engineering; Software Development Engineer 0 yes / 64 other
Apex Systems Llc 67 $3,322,074 62 62 38.7% PAARNCMNTXVAALGAMINJMARI Solutions Consultant; Software Engineer; Lead Consultant (Salesforce Architect); Project Technical Solution Architect; Lead Celonis Architect 1 yes / 61 other
Apex Systems Inc 38 $896,321 62 62 38.7% PAARNCMNTXVAALGAMINJMARI Solutions Consultant; Software Engineer; Lead Consultant (Salesforce Architect); Project Technical Solution Architect; Lead Celonis Architect 1 yes / 61 other
Ramboll Americas Engineering Solutions Inc 27 $298,922 62 62 3.2% ILNYWAVAUTTXGAMOAZKSCAFLPANJ Construction Manager; Environmental Engineering Manager; Environmental Data Engineer; Parametric & Computational Designer; Senior Environmental Scientist, Air Quality 0 yes / 62 other
Garver Llc 101 $11,673,680 61 61 63.9% ARTXKSAZSCCOCT Project Engineer; Project Manager; Project Engineer (Transportation); Senior Process Mechanical Engineer; Structural Engineer 0 yes / 61 other
Hill International Inc 25 $1,327,649 61 61 1.6% DCCAPANJNYFLAZTXWA Scheduler; PROJECT ENGINEER; Assistant Project Manager; Project Manager; IT Project Manager 0 yes / 61 other
Public Consulting Group Llc 16 $9,520,836 60 60 26.7% TNTXCTPAMACARINCFLNYNHNJAZ Sr. Consultant; Business Intelligence Developer; Cloud Engineer II; Cloud Engineer III; Lead Software Engineer 0 yes / 60 other
Harris County Hospital District 8 $614,061 60 60 100% TX Epic Business Analyst III; Sr. Healthcare Data Analyst; IAM Software Engineer Lead; Healthcare Business Analyst II (CHC); ERP Software Engineer III 0 yes / 60 other
Kimley-Horn And Associates Inc 97 $11,722,877 59 60 18.6% ILGATXFLCAINVAAZNCNYNJMD Civil Analyst; Civil Engineer; Structural Engineer; Landscape Architect; Electrical Engineer 3 yes / 56 other
Kimley Horn And Associates Inc 5 $10,760 59 60 18.6% ILGATXFLCAINVAAZNCNYNJMD Civil Analyst; Civil Engineer; Structural Engineer; Landscape Architect; Electrical Engineer 3 yes / 56 other
Professional Service Industries Inc 5 $118,198 58 58 58.6% TXOHMIWIARFLORTNLAVAMN Project Engineer; Staff Engineer; Staff Engineer, Geotechnical; Geotechnical Project Engineer; Staff Engineer - Construction 0 yes / 58 other
Midwestern State University 1 $320 58 58 100% TX International Recruitment and Retention Specialist; Associate Professor and Chair of Social Work; Assistant Professor of Engineering; Lecturer; Assistant Professor 0 yes / 58 other
Digerati Systems Inc 32 $531,880 57 57 35.1% FLTXILWICAVANYWACTSCAZMINE Software Engineer; Network Security Engineer; Software Developer; Software Developer(Share Point Developer); Java Angular Developer 52 yes / 5 other
Texas A&M University-Central Texas 1 $56,015 57 57 100% TX Assistant Professor; ASSISTANT PROFESSOR; Research Associate; Research & Reporting Analyst; VISITING ASSISTANT PROFESSOR 0 yes / 57 other
Bruker Nano Inc 1 $9,670 57 57 0% MNCAWIFLWAORMANYNC PRODUCT SUPPORT ENGINEER; APPLICATIONS ENGINEER; APPLICATIONS ENGINEER - SEMICONDUCTOR; FIELD SERVICE SYSTEMS APPLICATIONS ENGINEER; ELECTRICAL ENGINEER 0 yes / 57 other
Dell Marketing Lp 1 $8,572 57 57 87.7% TXMAWAGACA Consultant, Business Intelligence; Senior Advisor, Merchandising; Senior Advisor, Product Marketing; Consultant, Product Marketing; ADVISOR, MARKETING OPERATIONS 0 yes / 57 other
Transcore Lp 5 $321,642 56 56 35.7% TXNYNJNCPAMDMNTNCA Software Engineer; Scrum Master/Technical Project Manager; Database Administrator; Software Architect; Vice President, Operations 8 yes / 48 other
Angelo State University 6 $3,303 56 56 100% TX Assistant Professor; Assistant Professor of Management; Associate Professor; Assistant Professor of Athletic Training; Assistant Professor of Marketing 0 yes / 56 other
Ryan Companies Us Inc 6 $381,991 55 55 23.6% GAAZILTXWAFLMNCAOK Senior Project Engineer; Project Manager II; Project Engineer; Project Manager; Preconstruction Manager I 0 yes / 55 other
Quadient Inc 1 $10,944 55 55 12.7% INTXCTPANJGACA Senior Oracle Application Developer; Business Intelligence Manager; Oracle Database Administrator; CRM Lead; Sr. Integration Engineer 3 yes / 52 other
Stephen F Austin State University 15 $895,730 54 54 100% TX Assistant Professor; Assistant Professor of Biology; Asst. Professor of Business Communication & Legal Studies; Assistant Professor - Economics; Associate Professor of Management and Marketing 0 yes / 54 other
Ecs Southwest Llp 14 $57,994 53 53 84.9% TXAZCAUTOK Geotechnical Project Manager; Geotechnical Staff Project Manager; Geo Staff Project Manager; Geotechnical Department Manager; Geotechnical Project Engineer II 0 yes / 53 other
Woolpert Inc 63 $7,527,189 52 52 44.2% FLILCOTXOHCAINVAMANYMI Wastewater Engineer; Civil Engineer; Engineer in Training I; Designer; Engineer I 0 yes / 52 other
Freese And Nichols Inc 4 $4,593,100 52 52 96.2% TXNCOK Engineer III; Engineer IV; Engineer II; Engineer IV (Water/Wastewater Treatment Engineer); Design Professional II 0 yes / 52 other
American Structurepoint Inc 23 $1,462,191 52 52 21.2% INTXOHFL Staff Engineer; Traffic Staff Engineer; Project Engineer; Sr. Traffic Engineer; Senior Project Engineer 0 yes / 52 other
Bexar County Hospital District 22 $760,354 52 53 100% TX Internal Medicine Physician; Endocrinologist; Family Medicine Physician; Psychiatrist; Family Practice Physician 0 yes / 52 other
Transunion Risk And Alternative Data Solutions 6 $1,188 52 52 13.5% FLTXILCA Lead Developer; Senior Developer; Consultant; Manager; Senior Engineer 0 yes / 52 other
Iteris Inc 7 $91,601 50 50 16% TXCAFLVA Associate Engineer; Engineer; Senior Software Engineer; Software Developer; Sr. Engineer 2 yes / 48 other
Mindfore Inc 12 $192,982 49 49 67.3% CATXNJAZOHTNMAVA Software Developer; JAVA FULL STACK DEVELOPER; Software Quality Assurance Analysts and Tester; SAP Technical Consultant; SAP SD Consultant 4 yes / 45 other
Pape-Dawson Consulting Engineers Llc 81 $10,590,527 48 48 95.8% TXFL ENGINEER II; Engineer I; ENGINEER IV; Project Engineer; Engineer IV 0 yes / 48 other
Greenman-Pedersen Inc 4 $286,558 48 48 0% MINYMANJCTAZVAPAMD Senior Electrical Engineer; Designer; Electrical Engineer; Construction Manager/Resident Engineer; Transportation Engineer 0 yes / 48 other
Pape Dawson Consulting Engineers Llc 10 $106,688 48 48 95.8% TXFL ENGINEER II; Engineer I; ENGINEER IV; Project Engineer; Engineer IV 0 yes / 48 other
Pape-Dawson Consulting Engineers Inc 2 $47,237 48 48 95.8% TXFL ENGINEER II; Engineer I; ENGINEER IV; Project Engineer; Engineer IV 0 yes / 48 other
Gb Tech Inc 1 $192,869 47 47 8.5% VATXDENJCTNHMIMDILMA Software Developer; Computer Systems Analyst; Senior Systems Administrator; Database Architect 47 yes / 0 other
Legacy Community Health Services Inc 1 $100,000 47 47 100% TX Psychiatrist; Pediatrician; Physician - Internal Medicine/Endocrinology; Medical Director - Adult Medicine; BI Technical Director 0 yes / 47 other
Hendrick Medical Center 1 $2,688 47 47 100% TX Medical Technologist; Business Applications Analyst II; Shift Technical Supervisor (Medical Technologist); Technical Supervisor (HRL); Diagnostic Technologist I 0 yes / 47 other
Longview Independent School District 1 $2,500 47 47 100% TX Elementary Bilingual Teacher; Elementary Teacher; Spanish Teacher; High School Math Teacher; Bilingual Diagnostician 0 yes / 47 other
Henry Schein Inc 1 $520 47 47 8.5% TXNYGAPA Sr. IT Software Engineer II; Senior IT Software Engineer II; Sr. IT Software Engineer; Senior Programmer Analyst; Workday Tech Analyst 0 yes / 47 other
National Jewish Health 9 $1,465,995 46 48 0% CO Research Associate; Postdoctoral Research Fellow; Clinical Research Coordinator; Research Fellow; Bioinformatics Software Engineer 0 yes / 46 other
Walker Consultants Inc 6 $93,657 46 46 17.4% PACOCAGAMNNYNCTXFLWA Restoration Consultant; Design Engineer; Project Engineer; Building Envelope Specialist; Restoration Engineer 0 yes / 46 other
M9 Consulting Inc 67 $1,913,017 45 45 40% DCMDNCTXAZKSMAFLNYWACAAR Software Engineer; Ruby On Rails Developer; Java Developer; Professional Programmer Analyst; Sr. Desktop Engineer 45 yes / 0 other
The Nature Conservancy 4 $27,084 45 45 0% MAVAMECOWIGAFLKYMINYNCIACTILAZ Financial Modeling Analyst, Sustainable Debt; Global Renewable Energy Program Coordinator; Sr. Information Technology Analyst; Director of Marketing, Caribbean; Finance/Accounting Specialist II 0 yes / 45 other
Sul Ross State University 2 $14,042 44 44 100% TX Director of Residential Living; Associate Professor of Economics; Visiting Professor of Marketing and Entrepreneurship; Associate Professor of Physics and Astronomy; Research Scientist, Landscape and Range Ecology 0 yes / 44 other
Bhs Physicians Network Inc 11 $4,561 43 43 100% TX Physician; Physician - Neuro Endovascular Surgeon; Physician - Hospitalist; Physician/Anesthesiologist; Physician - Neurology 0 yes / 43 other
Affiliated Engineers Inc 2 $190,547 42 42 0% NCAZWIOHKSILMDWA Building Performance Consultant I; Commissioning Engineer I; Project Engineer - Intelligent Buildings; Electrical Engineer I; Mechanical Engineer II 0 yes / 42 other
Applied Research Associates Inc 10 $570,981 41 41 2.4% ILALCAMSPATXFL STAFF CIVIL ENGINEER; STAFF SOFTWARE ENGINEER; SENIOR CIVIL ENGINEER; Senior Consultant 1; SENIOR ENGINEER 0 yes / 41 other
Timeclock Plus Llc 2 $2,804 41 46 68.3% TXNCCOUTWAMDVAMA Computer Programmer; Software Engineer; Software Engineer IV; Dev Ops; Financial Analyst 0 yes / 41 other
Datamanusa Inc 31 $856,021 40 40 17.5% TXAZCOFLNJNMILVAWA IT Project Manager; Computer Programmer; Java Developer; Business Analyst; QA Engineer 3 yes / 37 other
Datamanusa Llc 36 $456,734 40 40 17.5% TXAZCOFLNJNMILVAWA IT Project Manager; Computer Programmer; Java Developer; Business Analyst; QA Engineer 3 yes / 37 other
Scott & White Memorial Hospital 6 $1,950 40 40 100% TX Therapeutic Medical Physicist II; Physical Therapist I; Perfusionist; Medical Lab Scientist 2; Research Associate 1 0 yes / 40 other
Bcc Engineering Llc 4 $843,784 38 38 2.6% FLSCGATX Roadway Engineering Designer; Engineering Designer; Roadway Engineer; Transportation Engineer; Structural Engineer 0 yes / 38 other
Ost Inc 7 $159,105 38 38 0% VADC SOFTWARE (.NET) DEVELOPER; STATISTICAL ASSISTANT; SYSTEMS ADMINISTRATOR; IT PROJECT MANAGER; .NET DEVELOPER 0 yes / 38 other
John Bean Technologies Corporation 1 $118,320 38 38 7.9% CAARMITXWAOHUTGANCPANY Spare Parts and Service Manager; Customer Care Senior Business Analyst; Software Engineer; Customer Care System Upgrade Engineer Lead; Account Manager, Small Customer 0 yes / 38 other
Nextgen Information Services Inc 5 $65,251 38 38 7.9% ILTXNCOHMO QA Analyst; Sr. Programmer Analyst; Quality Analyst; Programmer Analyst - AI Product & Application Services Devel; Operational Excellence Analyst 2 yes / 36 other
University Health System 6 $46,098 38 38 0% TN Physician Pulmonologist; Plastic and Reconstructive Surgeon; Physician Gastroenterologist; University Cardiology Physician; Physician Rheumatologist 0 yes / 38 other
Raba Kistner Inc 45 $4,446,779 37 37 100% TX Engineer In Training I; Software Analyst IV; Quality Assurance Analyst II; CoMET Supervisor; Software Developer IV 0 yes / 37 other
Westat Inc 7 $1,537,707 37 37 0% MDDC Survey Sampling Statistician; Systems Analyst; Survey Methodologist; Mobile Application Designer; Statistician 0 yes / 37 other
C&T Information Technology Consulting Inc 70 $1,203,595 37 37 97.3% TXVA Project Manager; Sr. Applications Developer; Functional Analyst; Identity & Access Management Developer; Developer Analyst 37 yes / 0 other
Consor North America Inc 2 $6,652 37 37 43.2% UTTXCAORWAFLSCCT Project Engineer; Engineering Designer; Professional Engineer; Project Manager; Assistant Construction Project Manager 0 yes / 37 other
Radiology Partners Inc 2 $644 37 37 18.9% PAFLCAWIOHTXNC Manager, IT Data Integration Development; Manager, Practice Analytics; Senior Manager, Quality Assurance; Senior Cloud Platform Engineer; Senior Manager, Software Development 2 yes / 35 other
Bureau Veritas North America Inc 7 $528,991 36 36 38.9% NVCATXNYMI Transportation Engineer; Business Analyst; Project Manager; Drilling Completion Project Engineer; Senior RCFA Analyst 0 yes / 36 other
Broadaxis Inc 22 $373,689 36 43 63.9% TXWAVAOH Computer Systems Engineer; Data Engineer; Software Developer; Human Resources Specialist; Senior Database Administrator 0 yes / 36 other
Active Cyber Llc 3 $300,000 36 36 47.2% TXCAPAGAAZ Software Developer; Software Applications Developer; Identity Access Management Software Applications Developer; IT Project Manager; Software Quality Assurance Engineer/Tester 2 yes / 34 other
Kci Technologies Inc 37 $1,974,573 35 35 42.9% TXPANYMDVADCNC Project Manager; Construction Quality Control Manager; Project Engineer; Water/Wastewater Project Engineer; Engineer-In-Training 0 yes / 35 other
Innosoul Inc 50 $1,280,659 35 35 14.3% ILMNTXNCOHNY Technical Architect; WTX / WPS Developer; Curam Developer; WAS Administrator; Junior Curam Developer 1 yes / 34 other
Buzzclan Llc 11 $170,247 35 35 80% MOTXILMN IT Project Manager; Computer Programmer; Director - Data Ops; Technical Project Manager; Principal Associate (Azure Lead) 0 yes / 35 other
The University Of Texas At El Paso 8 $85,703 35 35 100% TX Assistant Professor; Clinical Assistant Professor; Engineer -TMAC; Engineer-TMAC; Engineer- TMAC 0 yes / 35 other
Engie Insight Services Inc 6 $16,346 35 35 5.7% WACATXNYILMA Senior Data Integration Engineer; Principal Software Engineer; Consultant, Decarbonization Sustainability Solutions; Senior Manager, On-Site Energy Solutions; User Experience (UX) Designer 0 yes / 35 other
Vwr International Llc 1 $7,680 35 35 8.6% FLNJVANYPATXAZ Senior Manager, Cell & Gene Therapy Product Strategy; Manager, Research & Development; Manager 1, Data & Analytics; Data Scientist; Senior Technical Packaging Engineer 0 yes / 35 other
Proventus Metrics Inc 12 $779,174 34 34 97.1% TXGA SOFTWARE DEVELOPER; SOFTWARE DEVELOPER 3; SOFTWARE DEVELOPER 2 0 yes / 34 other
Texas Comptroller Of Public Accounts 128 $571,887 34 34 100% TX SOFTWARE DEVELOPER; Sr. Software Developer; PeopleSoft Consultant; Full Stack React Developer; PeopleSoft Analyst 28 yes / 6 other
Rose International Inc 6 $93,202 34 34 0% MOCAWANYGAMDILMN Client Engagement Associate; SENIOR TECHNICAL RECRUITER; ADOBE EXPERIENCE MANAGER TECHNICAL LEAD; AGILE COACH; BUSINESS SYSTEMS ANALYST 0 yes / 34 other
Texas A&M Forest Service 8 $73,671 34 34 100% TX Geospatial Analyst II; Geospatial Analyst I; GEOSPATIAL DATABASE ADMINISTRATOR III; Geospatial Developer IV; GEOSPATIAL DEVELOPER II 0 yes / 34 other
Msys Inc 4 $60,112 34 34 20.6% CATXTNPASCAZNJILMAVAMDMODC SOFTWARE DEVELOPER; QA AUTOMATION LEAD; QA ANALYST; PROJECT MANAGER; SENIOR PROGRAMMER 0 yes / 34 other
Sovos Compliance Llc 2 $25,000 32 32 0% GAPANYCAVAMNMANC Vice President, Business Applications; PS Operations Analyst II; Senior Software Engineer; Senior Business Applications Admin/Developer; SENIOR SOFTWARE ENGINEER (10654.53.3) 0 yes / 32 other
Texas A&M Veterinary Medical Diagnostic Laboratory 1 $795 32 32 100% TX Veterinary Pathologist; Lead Scientist; Assistant Agency Director and Virology Section Head; IT Business Analyst II; Bacteriology Section Head 0 yes / 32 other
Inteliblue Llc 25 $744,961 31 31 22.6% TXARNJMIDEUT Technical Project Manager; Database Administrator; Senior Database Administrator; DevOps Engineer; Senior .Net Programmer 0 yes / 31 other
Cdw Government Inc 17 $1,177,496 30 30 10% VAPANYINTXWAOHMDNJ Software Engineer III; Product Manager; Network Security Engineer; Sr. Network Security Engineer; Analytics Data Engineer 2 yes / 28 other
Cdw Government Llc 11 $891,504 30 30 10% VAPANYINTXWAOHMDNJ Software Engineer III; Product Manager; Network Security Engineer; Sr. Network Security Engineer; Analytics Data Engineer 2 yes / 28 other
Prolim Global Corporation 30 $274,984 30 30 10% OHMINJTXNCWACOMOPA Teamcenter Developer; NX CAM APPLICATION ENGINEER; SAP Basis Consultant; Senior Software Engineer; Java Developer 27 yes / 3 other
Jensen Hughes Inc 15 $225,725 30 31 0% CAWAORVAMDNYIL Associate; Staff Engineer (Fire Protection Engineer); Staff Engineer; Lead Engineer; Project Manager 0 yes / 30 other
Serigor Inc 8 $107,960 30 30 0% NCMDDCILVA Dot Net Developer; Applications, Programmer; Software Developer; Project Manager; Technical Project Manager 0 yes / 30 other
Prolim Global Corp 5 $84,547 30 30 10% OHMINJTXNCWACOMOPA Teamcenter Developer; NX CAM APPLICATION ENGINEER; SAP Basis Consultant; Senior Software Engineer; Java Developer 27 yes / 3 other
Smith Seckman Reid Inc 2 $10,242 30 30 56.7% TNTXFLGA Plumbing Engineer II; Technology Designer II; Engineer I; Senior Medical Equipment Planner; Engineering Project Manager II 0 yes / 30 other
Wsb Llc 66 $9,225,519 29 29 44.8% TXCOMNOKFLND Graduate Engineer; Graduate Engineer - Traffic; Water/Wastewater Engineer; Project Manager / Sr. Traffic Engineer; Sr. Graduate Engineer 0 yes / 29 other
Beyond Engineering And Testing Llc 27 $1,003,815 29 30 100% TX Construction Engineer; Senior Project Manager; Staff CMT/ Civil Engineer; Civil/Geotechnical Project Engineer; Project Engineer II - Construction Engineer 0 yes / 29 other
Texas Woman'S University 29 $242,529 29 30 100% TX Assistant Professor; Assistant Professor of Management; Assistant Professor of Marketing; Assistant Professor of Finance; SharePoint Developer 1 yes / 28 other
Gsi Environmental Inc 1 $7,800 29 29 65.5% TXCACO Environmental Engineer II; Environmental Engineer; Environmental Scientist I; Scientist III; Environmental Geologist 0 yes / 29 other
Hvj Associates Inc 17 $1,369,075 28 28 100% TX Staff Engineer; Geotechnical Project Manager; PROJECT MANAGER; Professional Services Manager; Geologist 0 yes / 28 other
Abacus Technical Services Llc 12 $123,993 28 28 92.9% TXNY AA.COM DEVELOPER IV; AA.COM DEVELOPER I; Systems Analyst II; Sr Software Engineer; TIBCO DEVELOPER 0 yes / 28 other
Volkert Inc 67 $12,207,211 27 27 18.5% PANCFLVAALTXGA Project Engineer; Transportation Engineer; Design Engineer; Civil Engineer; Traffic Engineer 0 yes / 27 other
Dks Associates 16 $1,297,103 27 27 29.6% WATXCAOR Transportation Engineering Associate; Transportation Engineer in Training (EIT); Electromobility Engineering Associate; Transportation Engineer; Senior Transportation Engineer/Practice Lead 0 yes / 27 other
Procom Services America Inc 52 $359,850 27 27 48.1% CANYFLTXNJ Digital Software Engineer Lead Analyst; Senior Technical Program Manager; Logistics Project Analyst; Senior Full Stack React/Java Developer; Specialty Developer 0 yes / 27 other
Othon Inc 25 $1,876,739 26 26 88.5% TXCT Graduate Engineer; Engineer in Training; Transportation Graduate Engineer; Project Lead; PROJECT ENGINEER 0 yes / 26 other
Soal Technologies Llc 64 $1,315,326 26 26 92.3% TXMDPA Software Developer; Dynamics CRM Developer; Sr Full Stack Web Developer; Business Development Manager; Microsoft Dynamics CRM Developer 0 yes / 26 other
Toole Design Group Llc 16 $713,977 26 26 0% MDMASCCANCKSCOPA Project Engineer; Civil Engineer; Analyst II; Landscape Designer III; Designer III 2 yes / 24 other
Lone Star Circle Of Care 1 $100,000 26 26 100% TX Pediatrician; Dentist; Family Physician; Family Medicine Physician; MD-Child and Adolescent Psychiatrist 0 yes / 26 other
Navayuga Infotech Llc 6 $94,400 26 27 38.5% TXMIGAVANC Software Developer; Software Engineer; Computer Hardware Engineer; Data Engineer; Validation Engineer 10 yes / 16 other
Ulteig Engineers Inc 13 $2,373,121 25 25 4% OHNDNCCANJTXMNPA Engineering Supervisor; Project Manager - Renewables; Design Engineer; Transmission Line Engineer; Water Resources Engineer 0 yes / 25 other
Cliftonlarsonallen Llp 10 $1,645,080 25 25 8% NJCANCTXILMNNYFLWA Senior Associate; Senior Data Engineer; Lead Applications Developer; Senior, Assurance; Software Developer 2 yes / 23 other
Carnegie Learning Inc 5 $697,945 25 25 0% PACAAZNY Senior Software Engineer; Manager/Lead Software Engineer; Lead Software Automation Engineer; Brand and Content Manager; Software Engineer 0 yes / 25 other
Aya Healthcare Inc 85 $963,334 24 24 0% CAIL Software Engineer III; Manager, QA Engineering; Symfony Platform Manager; Sr. DevOps Engineer III; QA Engineer III 0 yes / 24 other
Mott Macdonald Llc 53 $718,502 24 24 41.7% NJTXNCMACAGA Engineer II - Electrical; Software Developer; Engineer III - Interconnection; Principal - Protection & Control; Engineer III - Distribution 3 yes / 21 other
Mckim & Creed Inc 3 $184,663 24 24 0% NCGAFLNJPA Engineering Designer - Mechanical; Electrical Designer/Electrical Engineer; E&I Designer I; Senior Project Engineer, Mechanical (HVAC); Project Engineer-Electrical 0 yes / 24 other
Lubbock County Hospital District 4 $5,210 24 24 100% TX Physical Therapist; Medical Lab Scientist; Associate Healthcare Systems Report Developer; Physical Therapist II; Physician 0 yes / 24 other
Denver Health And Hospital Authority 1 $100 24 24 0% CO Hospitalist; Neurosurgeon; Psychiatrist; Pediatric Critical Care Medicine Physician; Resident IV, Fellow 0 yes / 24 other
Applied Pavement Technology Inc 5 $206,649 23 25 0% ILNV Civil Engineer; Pavement Engineer 0 yes / 23 other
Mcconnell & Jones Llp 23 $1,366,234 22 22 50% MATXCAPA Audit Senior; Audit Staff; Audit Supervisor; Audit Manager; Senior Information Technology Auditor 0 yes / 22 other
Wiss Janney Elstner Associates Inc 21 $209,804 22 22 22.7% TXNYCAILNCVAIN Associate II; Associate III; Senior Associate; Building Science Associate; Associate II (Seismic Focus) 0 yes / 22 other
Anchor Qea Inc 15 $174,205 22 22 0% WAORCANJ Senior Professional; Staff 3 Engineer; Staff 2 Professional; Staff I Scientist; Staff 2 Professional/Planner/Natural Resource Specialist/Sci 0 yes / 22 other
The North Highland Company Llc 7 $157,850 22 22 9.1% GACANYILTXFL Master Practitioner, Data & Analytics; Director, Data And Analytics; MASTER PRACTITIONER; Consultant; AI & Data Engineer 0 yes / 22 other
East Texas A&M University 5 $97,440 22 22 100% TX Clinical Director and Assistant Professor; Assistant Professor; Communications Coordinator; Athletic Trainer; Student Development Specialist II 0 yes / 22 other
Johnson Controls Security Solutions 1 $44,846 22 22 22.7% ARTXIDFLVAALGA Program Support Specialist; DATA SCIENTIST; Robotic Process Automation (RPA) Modeler; Senior Data and Reporting Analyst; RPA Modeler 0 yes / 22 other
Dental Health Associates Of Texas Pc 10 $5,812 22 22 100% TX Dentist; General Dentist; DENTIST 0 yes / 22 other
West Marine Products Inc 1 $0 22 22 22.7% TXNCFLCASC CRM Analyst; Senior Business Intelligence Analyst; Sr. Dir. CRM, Loyalty, Res. & Analytics; Senior Network Engineer; SR. BUSINESS INTELLIGENCE ANALYST 0 yes / 22 other
Corsair Consulting Llc 4 $725,674 20 20 100% TX Staff Engineer; Staff Geotechnical Engineer; Project Geotechnical Engineer; Senior Geotechnical Engineer; Geotechnical Engineer 0 yes / 20 other
Wehire Technologies Llc 11 $326,485 20 20 85% TXGACA Business Analyst; Software Developer; Tester; Software Engineer; Quality Automation Engineer 0 yes / 20 other
Amistad Community Health Center Incorporated 1 $100,000 20 22 100% TX Pediatrician; Healthcare Analytics Developer; Healthcare Business Analyst 0 yes / 20 other
Skillsoft Corporation 3 $15,300 20 20 0% CAFLNYMANHRINC Software Engineer II; Sr Dir, Product Portfolio; Senior Software Engineer; Senior Financial Functional Analyst; Software Architect 0 yes / 20 other
Powerschool Corporation 2 $5,020 20 20 25% CAVAGATX Software Engineer; Software Security Architect; Cloud Security Architect; Lead Software Engineer; Manager, Product Management 0 yes / 20 other
Deque Systems Inc 1 $2,114 20 20 0% VAMIWACANCPA Senior Accessibility Consultant; Associate Solutions Engineer; Data Scientist; Software Developer (Android); Senior Software Engineer 0 yes / 20 other
Trimble Transportation Enterprise Solutions Inc 1 $1,121 20 20 15% OHNCTX Software Developer; Software Engineer; Sr. Software Engineer; Senior Software Developer; Technical Lead 0 yes / 20 other
Lockwood Andrews & Newnam Inc 68 $5,452,768 19 19 100% TX Civil Engineer; Structural Engineer-in-Training; Civil Engineer-in-Training; Water Resources Engineer; Project Engineer 0 yes / 19 other
Simcorp Usa Inc 12 $2,598,123 19 19 0% NYMAVA SYSTEMS ANALYST; Lead Software Engineer; Senior Financial Engineer; Head of Consulting, NA Investment Management Solution; Lead Technology Solutions 3 yes / 16 other
Geotest Engineering Inc 4 $1,834,189 19 19 100% TX Assistant Project Manager; Graduate Engineer; Project Engineer; Geotechnical Engineer; Asst. CoMET Manager 0 yes / 19 other
Alphaprimetech Inc 12 $200,288 19 19 0% DCCAVAMDNYAZMA Software Developer; PROGRAMMER ANALYST; Sr. Software Developer; ERP Technical Developer; SAP Business Object Developer 14 yes / 5 other
Chapin Hall Center For Children 6 $91,138 19 19 0% WIVAMAILKYOR Research Assistant; Researcher; Researcher (Data Engineer); Researcher (Social Science Data Engineer); Researcher (Data Analytics & Applied Statistics) 0 yes / 19 other
Travis County Emergency Physicians Pa 23 $16,042 19 21 100% TX Physician (Emergency Medicine) 0 yes / 19 other
Duane Morris Llp 1 $1,995 19 19 0% NYPADC Associate Attorney; Associate; Attorney; Patent Agent (Electrical Engineering); Test Case 0 yes / 19 other
Atlas Technical Consultants Llc 51 $5,002,958 18 18 0% INILNJGANVCANCNY Vice President (Program Manager III, Special Inspections); ENG Practice Team Manager 4; Civil Engineer II; GEO Program Manager 3; Engineer 1 0 yes / 18 other
Netsmart Technologies Inc 4 $1,563,460 18 18 11.1% KSTXNCCAMOMA Senior Software Engineer; Software Engineer; Software Architect; Lead Software Architect; QA Automation Architect 0 yes / 18 other
Stanley Consultants Inc 27 $523,397 18 18 50% TXIAFLCOILGA Engineer-in-Training II; Engineer; Protection and Controls Engineer-in-Training II; Senior Engineer; Electrical Engineer 0 yes / 18 other
Revvity Health Sciences Inc 5 $496,512 18 18 11.1% MANJGACTTXCA Manager IT - Data Engineering; Sr. Research Scientist; Sr. Technical Program Specialist; Principal IT Business Architect; Principal Data Engineer 0 yes / 18 other
Abacus Service Corporation 10 $239,237 18 18 33.3% CANJCONCOHMITXGAIN DATABASE ADMINISTRATOR; Operations Lead DBA; LCE PM Contract Engineer; (Agile1) Engineer; Scientist 2 - Clinical Research 1 yes / 17 other
Red Salsa Technologies Inc 15 $214,178 18 18 33.3% NJTXMDMNOKDC Principal Software Engineer; Systems Engineer; System Administrator; Technical Application Developer; Software Engineer 0 yes / 18 other
City Of San Antonio 12 $178,963 18 18 100% TX SAP Business Analyst; Software Engineer 2; Data Analyst; Debt Officer 17 yes / 1 other
Cherry Bekaert Advisory Llc 8 $172,800 18 18 11.1% CAILTXKYWAMDMAVA Assurance Associate; Tax Manager; Tax Senior; Staff Accountant; Staff Accountant, Assurance 0 yes / 18 other
Houston-Galveston Area Council 24 $170,613 18 18 100% TX 0 yes / 18 other
Alliant Insurance Services Inc 12 $50,676 18 18 5.6% NJTXNYCTVACAIL Senior Manager; Financial & Underwriting Analyst; International Benefits Consultant; Business Analyst II; Risk Data Analyst II 0 yes / 18 other
Cfa Institute 4 $4,376 18 18 0% GAVANYNCDC Data Analytics Engineer; NetSuite Developer; Software Developers - KBGFJG268103-3; Senior Product Manager IT; Senior Developer, Salesforce 2 yes / 16 other
Consolidated Electrical Distributors Inc 1 $2,507 18 18 83.3% TXMO Software Developer; Software Architect; Account Manager; Manager Trainee; Mobile Web Developer 9 yes / 9 other
Northgatearinso Llc 6 $5,992,582 17 17 5.9% TNFLOHTXGA IT Client Account Manager; Application Management, Lead Specialist; Technical Consultant; SAP Payroll Lead Specialist; SAP Basis Consultant 0 yes / 17 other
Carr Riggs & Ingram Llc 6 $401,471 17 17 29.4% TXFLLA Senior Accountant, Audit; SENIOR ACCOUNTANT, AUDIT; Audit Staff Accountant; Senior Accountant; Senior Accountant, Tax 0 yes / 17 other
General Datatech Lp 1 $343,106 17 17 100% TX Director US Operations; SAP Developer; Associate Solutions Architect; PS Engineer; Senior Network Systems Engineer 0 yes / 17 other
Education Service Center Region 20 2 $281,868 17 35 100% TX Lead Java Developer; Java Developer II; Developer/Analyst; Java Developer; SENIOR SOFTWARE DEVELOPER 0 yes / 17 other
Precision Task Group Inc 2 $35,488 17 17 100% TX ERP Technical Architect; Software Solutions Engineer; Director of Operations and Delivery; Workday Integrations Lead 0 yes / 17 other
Allana Buick & Bers Inc 5 $33,335 17 17 41.2% CANCTX Project Manager; Senior Consultant; Market Research Analyst; Mechanical Engineer; Staff Engineer 0 yes / 17 other
Texas A&M University-Texarkana 6 $17,174 17 17 100% TX ASSISTANT PROFESSOR; Instructional Designer II; Assistant Professor; Lecturer of Engineering and Director of Forest Products Exec; Engineering Laboratory Technical Coordinator 0 yes / 17 other
Childress County Hospital District 5 $4,620 17 17 100% TX MEDICAL TECHNOLOGIST 0 yes / 17 other
Texas A&M University - Texarkana 1 $1,946 17 17 100% TX ASSISTANT PROFESSOR; Instructional Designer II; Assistant Professor; Lecturer of Engineering and Director of Forest Products Exec; Engineering Laboratory Technical Coordinator 0 yes / 17 other
Johnson Mirmiran & Thompson Inc 118 $15,865,967 16 16 31.3% VADCTXNCMDDE Construction Scheduler; Bridge Project Engineer; Building/Facility Structural Engineer; Structures Design Engineer; Water/Wastewater Hydraulic Modeling Project Manager 0 yes / 16 other
Texas Workforce Commission 43 $3,151,437 16 16 100% TX DATA WAREHOUSE ARCHITECT-ETL DEVELOPER; Systems Analyst; Project Manager; PeopleSoft Systems Administrator; PROGRAMMER ANALYST 13 yes / 3 other
Civilcorp Llc 25 $1,675,884 16 16 100% TX Engineer-in-Training; Project Manager; TRANSPORTATION PROJECT MANAGER; ENGINEER-IN-TRAINING; Project Engineer 0 yes / 16 other
Arnamy Inc 6 $85,680 16 16 0% FLGA Database Administrator; Senior Programmer Analyst; Programmer Analyst; Software Engineer 0 yes / 16 other
Seyfarth Shaw Llp 2 $74,690 16 16 37.5% TXILNYCAMA Associate; Marketing & Business Development Coordinator; Attorney; Senior Fellow; Staff Attorney 0 yes / 16 other
Texas Education Agency 2 $16,477 16 16 75% NVTX SOFTWARE DEVELOPER; Software Developer; Business Analyst; Sr Business System Analyst; Data Scientist / Business Intelligence Analyst 16 yes / 0 other
Foster Llp 3 $9,835 16 16 18.8% CTTX 0 yes / 16 other
Healthtexas Provider Network 1 $1,102 16 16 100% TX Advanced Heart Failure Cardiologist; Clinical Exercise Physiologist 2; Cardiac Sonographer 2; Physician; Vascular Neurologist 0 yes / 16 other
Aptim Environmental & Infrastructure Llc 25 $1,259,114 15 15 33.3% FLTXNYGA Sr. Numerical Modeler; Senior Project Controls Specialist - 12141.5.8; Project Manager - 12141.43; Environmental Scientist; Project Management Analyst 0 yes / 15 other
Edgewood Partners Insurance Center 6 $29,013 15 15 0% NJNYCAGAMO Computer Programmer; Senior Specialist - Software Engineering; Vice President, Operations; Senior Analyst; New Business, Analyst 5 yes / 10 other
Ghd Services Inc 1 $2,332 15 15 53.3% NJPATXCAGU Data Scientist; Senior Air Quality Engineer; POWER SYSTEMS STUDY ENGINEER; Senior Environmental Engineer; Project Manager (Water/Wastewater) 0 yes / 15 other
Midland County Hospital District 2 $313 15 16 86.7% TXGA Clinical Laboratory Scientist II; Pharmacist; Application Support Analyst III; Clinical Informatics Analyst II; Data Integration Engineer III 0 yes / 15 other
Idcus Inc 26 $3,611,060 14 14 100% TX Engineer in Training; Graduate Engineer; Transportation Planner 0 yes / 14 other
Bamboo Health Inc 3 $1,132,438 14 14 14.3% FLTXCAINPAMANY Senior Software Engineer; FP&A Manager; Software Engineer; Sr. Software Engineer; Data Analyst 0 yes / 14 other
Teague Nall And Perkins Inc 15 $340,778 14 14 100% TX Project Engineer; Civil Engineer; Project Manager; Landscape Designer 0 yes / 14 other
Geographic Solutions Inc 3 $89,591 14 14 0% FL Senior Systems Integration Analyst; Programmer/Analyst III; UI Interfaces Team Lead I; Programmer/Analyst IV; Systems Integration Analyst 0 yes / 14 other
Akerman Llp 13 $70,850 14 14 28.6% TXNYCAFL Financial Systems Analyst; Associate; Associate Attorney; Associate Lawyer 0 yes / 14 other
Vexcel Corporation 10 $26,554,564 13 13 7.7% NYTX Systems Administrator II; SR. SYSTEMS ENGINEER II; SYSTEMS ENGINEER II; SYSTEM ADMINISTRATOR II; Senior Architect 12 yes / 1 other
Allied Consultants 138 $6,207,128 13 13 92.3% TXCA PeopleSoft Systems Administrator; Human Resources Specialist - Lead Recruiter; HR - Senior Technical Recruiter; Project Lead II; Retirement Plan Administrator 0 yes / 13 other
Allied Consultants Inc 24 $743,567 13 13 92.3% TXCA PeopleSoft Systems Administrator; Human Resources Specialist - Lead Recruiter; HR - Senior Technical Recruiter; Project Lead II; Retirement Plan Administrator 0 yes / 13 other
Rodriguez Engineering Laboratories Llc 12 $605,325 13 13 100% TX Civil Engineer; Civil Engineer (E.I.T); Project (Electrical) Engineer; Construction QA Manager; Construction Material Engineer (Civil Engineer) 0 yes / 13 other
Wynden Stark Llc 49 $380,778 13 13 38.5% NYTX Senior Vice President; Vice President - GQR Healthcare; Associate Vice President; Executive Vice President; Associate Director, Chief Customer Officer 0 yes / 13 other
Triwave Solutions Inc 8 $335,965 13 13 0% MDGANY Data Architect; ETL Developer; Software Developer; Senior Architect; Software Engineer 0 yes / 13 other
Flightsafety International 5 $120,813 13 13 7.7% OHNJTX Data Engineer; Senior Systems Engineer; Principle Software Engineer; Data Engineer, Business Intelligence & Analytics; Data Engineer, Data Analysis and Integration 0 yes / 13 other
Datavox Inc 1 $8,250 13 13 100% TX Microsoft Azure / 0365 Engineer; Cisco Certified Security Engineer; Electrical Engineer; Network Engineer; System Administrator 0 yes / 13 other
Canon Usa Inc 1 $6,157 13 13 0% NYNJNC Peoplesoft Developer; IBM WMB Developer; Network Engineer; Oracle Applications Developer; Software Developer, Oracle Application Technical 13 yes / 0 other
Office Of The Attorney General 52 $12,509,801 12 12 50% TXDC OAG Systems Engineer; System Administrator / System Engineer Master; SOFTWARE ENGINEER; Software Developer; Research Specialist V/Coleman Fellow 10 yes / 2 other
Adamas Technologies Inc 62 $1,117,536 12 12 100% TX Software Developer; Business Analyst; Network Engineer; Sr System Analyst 0 yes / 12 other
Hvj South Central Texas - M&J Inc 16 $1,098,916 12 12 100% TX Geotechnical Staff Engineer EIT; Staff Engineer; STAFF ENGINEER; CoMET Staff Engineer; CoMET Staff Engineer, EIT 0 yes / 12 other
Alis Software Llc 23 $591,915 12 12 100% TX Applications Architect; Project Manager; Sr DOT NET Developer; Data Scientist; Java Developer 0 yes / 12 other
Quisitive Llc 5 $324,880 12 12 25% ILTXCA 0 yes / 12 other
Jefferies Financial Group Inc 2 $66,638 12 12 0% NJNY SYSTEMS ENGINEER(SAN); SR. SPECIALIST - TECHNOLOGY; Sr. Specialist - Technology; Software Developer; BI DEVELOPER/ENGINEER 12 yes / 0 other
Hirevue Inc 1 $28,710 12 12 25% UTTXNCGA Senior Software Engineer; Regional Sales Manager- Enterprise; Senior Engineer QA/Automation; QA Engineer; Senior Architect 0 yes / 12 other
Nv5 Consultants Inc 1 $21,843 12 12 0% NCWACAFLILMNNY Executive Director; Associate Project Manager; Senior Energy Consultant; Principal; Energy Project Manager II 0 yes / 12 other
Thomson Reuters 8 $16,287 12 14 8.3% MNTX Project Manager; Programmer Analyst; Analyst Programmer; Specialist Leader; Software Developer 11 yes / 1 other
Zoho Corporation 1 $3,668 12 12 91.7% TXNJ ManegeEngine Technical Consultant; Director of Enterprise Business Solutions (EBS); Senior Solutions Architect; Technical Consultant; Business Development Manager 0 yes / 12 other
Centers For Medicare & Medicaid Services 8 $14,709,895 11 11 54.5% MDGATX Salesforce Developer/ Salesforce DevOps Engineer; Splunk Cloud Engineer; Software Developer; ENTERPRISE AI/ML ARCHITECT 11 yes / 0 other
Peraton Inc 6 $3,788,882 11 11 18.2% RITXVACA PEOPLESOFT SENIOR TECHNO FUNCTIONAL CONSULTANT; .Net Developer; Software Engineer; SOFTWARE DEVELOPER 8 yes / 3 other
Cp&Y Inc 18 $1,487,754 11 11 100% TX Electrical I&C Engineer; Project Engineer-Engineer 4; Engineer; Civil Engineering Specialist; Traffic Engineer 0 yes / 11 other
Mmgy Global Llc 18 $1,066,938 11 11 0% CANY ACCOUNT EXECUTIVE; Director of Client Services; Director of Marketing Services; Account Executive 0 yes / 11 other
Studio Outside Llc 6 $719,974 11 11 100% TX LANDSCAPE DESIGNER 0 yes / 11 other
Lubbock Regional Mhmr Center 10 $412,533 11 11 100% TX Psychiatrist; Computer Systems Architect 0 yes / 11 other
Mmgy Global Ltd 11 $269,670 11 11 0% CANY ACCOUNT EXECUTIVE; Director of Client Services; Director of Marketing Services; Account Executive 0 yes / 11 other
Talentech Digital Llc 9 $152,665 11 13 81.8% TXVA Software Engineer; Senior Software QA Engineer; Senior Software Engineer; UI/UX Designer; Software Developer 0 yes / 11 other
United Medical Centers 1 $100,000 11 11 100% TX Internist; Pediatrician; General Dentist 0 yes / 11 other
Loop Capital Markets Llc 2 $60,763 11 11 0% CANYIL Assistant VP, Investment Banking; Vice President (Senior), Investment Banking; Trading Associate; Associate; Analyst 0 yes / 11 other
Austin Community College 3 $33,160 11 11 100% TX Data Warehouse Administrator; Project Manager 1; MANAGER, SENIOR IT PROJECT; Systems Analyst; SALESFORCE ENGINEER 1 yes / 10 other
Fusionstak Llc 1 $16,200 11 11 0% LA Software Developer; DevOps Engineer; Software/Web Developer; Sr. Software Application Developer; Head of Engineering 1 yes / 10 other
Shannon Medical Center 3 $9,072 11 11 100% TX Medical Laboratory Technologist; Medical Technologist; Sr HR Systems Administrator Analyst; Automation Developer 3 yes / 8 other
Virtuous Software Inc 1 $5,650 11 11 0% WANJAZ Senior Software Engineer; Senior Data Scientist; Data Engineer; Senior Data Engineer 0 yes / 11 other
Ramsell Corporation 38 $8,511,674 10 10 10% CATX Senior Software Developer; Sr. Database Administrator 0 yes / 10 other
Nwn Corporation 8 $7,033,808 10 10 0% NCMACOCT Principal Consultant; Principle Consultant; Senior Business Analyst - ERP; Senior Solution Engineer; Junior Solution Engineer 1 yes / 9 other
Wgi Inc 13 $1,025,136 10 10 10% FLTXVA Landscape Architecture Project Manager; Structural Engineer; Landscape Architecture Senior Designer; Landscape Architect / Project Manager; Landscape Designer 0 yes / 10 other
Mobile Communications America Inc 4 $678,438 10 10 10% MDILNCVATXGA Senior Engineer; Engineering Supervisor; Distributed Antenna Systems Engineer; RF Engineer II; Senior RF Engineer 0 yes / 10 other
Idea Technologies Llc 40 $623,861 10 10 80% TXNCWA Software Engineer; Cloud Data Engineer; Software Developer; Software Development Engineer (SDE) and Quality Assurance (Q; Lead Principal Architect 1 yes / 9 other
Health And Human Services Commission 5 $367,222 10 10 100% TX Software System Analyst; Project Manager; SYSTEMS ANALYST; Computer System Analyst; Software Developer 5 yes / 5 other
Hardesty & Hanover Llc 3 $217,457 10 10 10% NHNYNCFLTXNJ 0 yes / 10 other
Bayinfotech Llc 5 $44,496 10 10 0% CA Computer Network Architect; Biomedical Engineer; ASP.NET Developer; Systems Engineer 0 yes / 10 other
Spire Consulting Group Llc 5 $38,651 10 10 100% TX Civil Engineer; Cost Consultant; Associate Civil Engineer II; Engineering Associate Consultant; Project Manager 0 yes / 10 other
El Paso County Hospital District 15 $20,812 10 10 100% TX Pediatric Neurosurgeon - Vice Chief Neuroscience Dept.; PHYSICAL THERAPISTS; Endocrinologist; Obstetrician and Gynecologist 0 yes / 10 other
Clark Equipment Company 1 $11,400 10 10 0% NCMN Solution Architect; GCC Controller; Supplier Development Engineer Sr; Business Process Manager; PIT SOLUTION EXPERT 0 yes / 10 other
Texas Association Of School Boards Inc 1 $50 10 10 100% TX Integration Developer; Manager, Enterprise MDM/BI; Senior EBX Architect & Developer; Sr. EBX Architect and Developer; Dimensional Data Modeler 0 yes / 10 other
Vrx Inc 39 $5,878,763 9 9 100% TX Senior Project Engineer; Project Engineer; Bridge Engineer; Assistant Program Manager (DFW Program); Assistant Project Manager 0 yes / 9 other
Omega Engineers Inc 61 $5,791,709 9 9 100% TX Engineer-in-Training; Hydrologist; Project Engineer; Engineer in Training (EIT); Water Resources EIT 0 yes / 9 other
Binkley & Barfield Inc 31 $2,477,286 9 9 100% TX Design Engineer; Project Engineer; Geospatial Solutions Architect; Design Project Manager; Design Project Engineer 0 yes / 9 other
Metropia Inc 4 $800,000 9 9 33.3% TXAZ Transportation Engineer; Market Research Analyst 0 yes / 9 other
Hr Green Inc 17 $618,007 9 9 77.8% TXMOCO Project Manager; Project Engineer I; Staff Engineer I 0 yes / 9 other
University Of Texas At El Paso 4 $342,479 9 9 100% TX Assistant Professor; Postdoctoral Fellow; Departmental Application Specialist 0 yes / 9 other
Rve Inc 3 $196,506 9 9 33.3% AZFLTX Planner; Landscape Designer; Senior Landscape Designer; Staff Designer; Senior Data Analyst 0 yes / 9 other
Kirksey Architects Inc 4 $134,506 9 9 77.8% TXUT Building Performance Analyst; Building Performance and Sustainability Specialist; Emerging Professional 0 yes / 9 other
Aptim Federal Services Llc 2 $131,890 9 9 11.1% OHGUNJTX Engineer (12141.47.1); Environmental Engineer; Deputy Project Manager; Senior Research Scientist; Field Project Engineer 0 yes / 9 other
Health Center Of Southeast Texas 1 $100,000 9 9 100% TX Psychiatrist; Family Practice Physician; Pediatrician 0 yes / 9 other
Trued Consulting Llc 1 $92,024 9 9 0% CAINNC DATA ANALYST/MODEL BUILDER; Analyst; DATA ANALYST 0 yes / 9 other
Us Tech Solutions Inc 16 $86,587 9 9 0% ILCANJNY SOFTWARE DEVELOPER; SYSTEMS ENGINEER; RECRUITMENT MANAGER 0 yes / 9 other
Respec Company Llc 13 $75,715 9 9 22.2% TXKYCONM Stormwater Development Engineer; Underground Storage Engineer; Mining Engineer; Mine Reclamation Engineer; Geological Engineer 0 yes / 9 other
The Hanover Research Council Llc 1 $59,500 9 9 0% MDVAILMICA Research Associate; Content Director, Level II; Senior Research Associate (Content Analyst); Research Associate (Data Analytics); Research Analyst 0 yes / 9 other
Texas A&M University System 2 $50,737 9 9 100% TX Associate Director, Workday Services; ENTERPRISE INTEGRATION ENGINEER II; Software Applications Developer IV; IT BUSINESS ANALYST III; ASSOCIATE DIRECTOR, WORKDAY SERVICES 0 yes / 9 other
Sinequa Corp 1 $50,000 9 9 0% NYMA Senior Solution Engineer; Senior Sales Engineer; Associate General Counsel; Solution Engineer; Search Cloud Engineer 0 yes / 9 other
Onestaff Medical Llc 10 $40,333 9 9 0% NE Software Developer 5 yes / 4 other
Nacogdoches Independent School District 2 $27,174 9 9 100% TX Secondary Mathematics Teacher; Secondary Mathemathics Teacher; Secondary Foreign Language Teacher 0 yes / 9 other
Bokf Na 2 $17,884 9 9 11.1% OKTXIAKS Technical Analyst IV; Solutions Architect; Software Developer II; Enterprise Cybersecurity Architect; IT Applications Manager 0 yes / 9 other
Airbus Helicopters Inc 1 $8,250 9 9 88.9% TXMS Director, Commercial Offers and Contracts; Cisco Voice Engineer; Lead A/C Technician; MRO Business Analyst; SAP Business Analyst (FI-CO) 2 yes / 7 other
Pfm Asset Management Llc 1 $6,000 9 9 0% PA Senior Credit Analyst; INTERMED RESEARCH ANALYST - FIXED; PORTFOLIO MANAGER; Manager, Research and Portfolio Strategist; Manager, Research and Portfolio Strategy 0 yes / 9 other
Sinequa 1 $4,500 9 9 0% NYMA Senior Solution Engineer; Senior Sales Engineer; Associate General Counsel; Solution Engineer; Search Cloud Engineer 0 yes / 9 other
Hitchcock Design Inc 1 $3,000 9 9 100% TX Project Designer (Junior Associate Landscape Architect); Project Designer (Junior Associate II - Landscape Architect) 0 yes / 9 other
Idemia Identity & Security Usa Llc 7 $210 9 9 0% MAVAPA PROJECT MANAGER; Senior Software Developer; FINANCIAL PLANNING AND ANALYSIS MANAGER; SENIOR SOFTWARE DEVELOPER 0 yes / 9 other
Aig Technical Services Llc 26 $4,346,437 8 8 100% TX AIG TECHNICAL SERVICES LLC; PROJECT MANAGER-TRAFFIC; WATER RESOURCES ENGINEER; Transportation Engineer; Engineer in Training 0 yes / 8 other
Iea Inc 36 $3,017,179 8 8 100% TX Civil Engineer; Civil Engineer- Water Resources; Civil Engineer (Structural EIT); SENIOR PROJECT MANAGER 0 yes / 8 other
Surveying And Mapping Llc 31 $2,022,236 8 8 62.5% TXFLMD Project Manager; Sr. Digital Consultant; Staff Engineer; Phase Manager 0 yes / 8 other
North Central Texas Council Of Governments 6 $530,520 8 8 100% TX 0 yes / 8 other
Alliance Transportation Group Llc 13 $379,738 8 8 100% TX Traffic Engineer; Travel Demand Modeler 0 yes / 8 other
Software People Inc 14 $365,233 8 8 0% SCNCNJNYPA Technical Test Lead; Software Build/Release Admin; PROJECT MANAGER; DIRECTOR- PROJECT MANAGEMENT OFFICE; Project Manager 0 yes / 8 other
Infratech Engineers & Innovators Llc 3 $245,944 8 8 75% TXVA Staff Engineer; Senior Structural Engineer; Traffic Study Specialist; Project Engineer; Staff Structural Engineer 0 yes / 8 other
Bestica Inc 9 $111,391 8 8 12.5% NJTX Technical QA Manager; Sr. User Experience Designer; PROJECT MANAGER, CLIENT SERVICES 0 yes / 8 other
Askreply Inc 4 $106,399 8 8 12.5% FLTXKS .Net Application Developer II; Software Engineer IV; Software Engineer I; Software Engineer III; .NET Applications Developer II 0 yes / 8 other
Intera Inc 6 $96,924 8 8 25% COFLTXCA Senior Hydrogeologist; Coastal Engineer; Hydrogeologist; Groundwater Modeler; Senior Water Resources Engineer 0 yes / 8 other
Quantadigit Llc 5 $82,840 8 8 0% VANJ SOFTWARE QUALITY ASSURANCE ENGINEER/ANALYST 0 yes / 8 other
Shannon Clinic 13 $13,748 8 8 100% TX Psychiatry Mental Health Nurse Practitioner - Certified; Hospitalist; Emergency Medicine Physician; Non-Invasive Cardiologist 0 yes / 8 other
Clearview Ai Inc 1 $10,990 8 8 0% CANY Product Manager -- Business Analyst; Data Operations Engineer; Product Manager -- Engineer; Business Intelligence Analyst -- Product Manager 0 yes / 8 other
Smart It Pros Inc 7 $9,905 8 8 37.5% CATXPAMOMINC Software Engineer; SAP Consultant; IT Consultant 0 yes / 8 other
Texas Department Of State Health Services 8 $5,252 8 8 100% TX Database Administrator; Research Specialist IV; SENIOR IT QUALITY ANALYST; Data Analyst III 4 yes / 4 other
Altec Industries Inc 1 $3,912 8 8 0% NCNY APPLICATIONS ENGINEER II; ENGINEER II; STAFF ENGINEER 0 yes / 8 other
Arias & Associates Inc 1 $3,387 8 8 100% TX GRADUATE ENGINEER; Graduate Engineer; GEOTECHNICAL ENGINEER 0 yes / 8 other
Texas Department Of Criminal Justice 9 $1,873 8 8 100% TX SOFTWARE DEVELOPER; Software Engineer 5 yes / 3 other
Inform Diagnostics Inc 1 $125 8 8 62.5% AZTX 0 yes / 8 other
Lja Engineering Inc 98 $17,572,517 7 7 85.7% COTX Vice President; Graduate Engineer; Civil Engineer (Design Engineer); Vice-President, Electrical & Instrumentation; Vice President-Electrical 0 yes / 7 other
Halff Associates Inc 139 $16,137,583 7 7 57.1% TXFL Project Engineer; Landscape Designer; Landscape Architectural Drafter 0 yes / 7 other
Rs&H Inc 45 $15,998,629 7 7 0% MDAZVAIL Senior Traffic Engineer; Engineering Task Leader - IPA; Project Development Engineering Associate I; Airfield Engineering Associate I; Airfield Civil Engineer III 0 yes / 7 other
H W Lochner Inc 65 $8,699,612 7 7 0% FLUTRIKSIN Traffic Engineer; TRAFFIC ENGINEER; Inspector II; ENGINEER ASSOCIATE II; STRUCTURAL DESIGN ENGINEER 0 yes / 7 other
Cobb Fendley & Associates Inc 78 $6,314,706 7 7 100% TX Principal Project Engineer Group Lead; Project Engineer Team Lead 0 yes / 7 other
Connecttel Inc 46 $1,479,849 7 7 100% TX Software Engineer; Senior Software Engineer 0 yes / 7 other
Internal Data Resources Inc 28 $760,313 7 10 14.3% TXTNVANC Software Development Engineer in Test; software developer; software quality assurance tester; Computer Systems Engineer; Computer Ocupation 0 yes / 7 other
Eagle Investment Systems Llc 2 $355,951 7 7 0% MA SOFTWARE APPLICATIONS DEVELOPER; Specialist Developer 0 yes / 7 other
Texas A&M Engineering Extension Service 35 $259,699 7 7 100% TX Software Applications Developer III; INSTRUCTIONAL DESIGNER II; INSTRUCTIONAL DESIGNER I 0 yes / 7 other
Swca Inc 21 $176,744 7 7 14.3% NVUTTXCO Associate Project Architectural Historian; GIS Specialist; Assistant Project Environmental Planner; Assistant Project Archaeologist; Staff Biologist 0 yes / 7 other
North Central Texas Community Health Care Center 1 $100,000 7 7 100% TX Family Nurse Practitioner; Nurse Manager; Dentist 0 yes / 7 other
Traf-Iq Inc 3 $96,063 7 7 100% TX ASSOCIATE ENGINEER; STAFF ENGINEER; Associate Engineer 0 yes / 7 other
Masterapp Labs Llc 3 $48,336 7 7 0% GAMI Software Developer 1 yes / 6 other
City Of Dallas 3 $43,546 7 7 100% TX NETWORK SECURITY ENGINEER; Network Engineer; Salesforce Developer; Senior Budget Analyst 9436960 6 yes / 1 other
Schaumburg & Polk Inc 2 $23,273 7 7 100% TX Project Engineer; Staff Engineer (E1) 0 yes / 7 other
Cobb Fendley & Associates 1 $5,100 7 7 100% TX Principal Project Engineer Group Lead; Project Engineer Team Lead 0 yes / 7 other
National Center For State Courts 1 $495 7 7 0% VA Data Scientist 0 yes / 7 other
Hendrick Medical Center Brownwood 4 $182 7 7 100% TX Hospitalist Physician; Clinical Laboratory Scientist; Hospitalist Physcian 0 yes / 7 other
Lina T Ramey & Associates Inc 58 $6,847,962 6 6 100% TX Project Engineer; Design Engineer 0 yes / 6 other
Nossaman Llp 18 $1,234,359 6 6 0% CA Law Associate (lawyer); Lawyer; Associate; Partner 0 yes / 6 other
Savvy Technology Solutions Llc 33 $1,131,415 6 6 0% IL Software Developer; IT Project Manager 0 yes / 6 other
The Gordian Group Inc 39 $480,771 6 6 0% SC Senior Manager, Software Development; Senior Software Developer; Sr. Software Developer; Manager, Software Development 0 yes / 6 other
Texas Parks & Wildlife Department 6 $360,676 6 6 100% TX SECURITY VULNERABILITY ENGINEER; JEE Software Developer 6 yes / 0 other
Houston Advanced Research Center 9 $315,957 6 6 100% TX Research Associate-Clean energy; Conservation Scientist - Climate Change; Software Developer; GIS Developer 0 yes / 6 other
Info-Tech Research Group Inc 4 $202,514 6 6 0% ILPA Associate; Senior Associate 0 yes / 6 other
Bracewell Llp 19 $158,043 6 6 16.7% NYTX Associate Attorney 0 yes / 6 other
East Texas Border Health Clinic 1 $100,000 6 6 100% TX Family Physician; Physician - Hospitalist 0 yes / 6 other
Sid Peterson Memorial Hospital 24 $94,980 6 6 100% TX Sid Peterson Memorial Hospital; Advanced Practice Registered Nurse - Adult and Gerontology 0 yes / 6 other
Se3 Llc 2 $50,390 6 6 66.7% ILTX PROJECT ENGINEER; Staff Engineer 0 yes / 6 other
Pbk Architects Inc 8 $44,701 6 6 50% GATXCA Building Envelope Project Manager; MECHANICAL DESIGNER; Structural Senior Project Manager; SENIOR CIVIL PROJECT MANAGER 0 yes / 6 other
Lexipol Llc 2 $26,580 6 6 33.3% TXNC Sr. Product Manager, Corrections; Director of Product, Policy & Performance Solutions 0 yes / 6 other
Dally Associates Inc 1 $15,500 6 6 100% TX Project Engineer; Assistant Project Manager; PROJECT ENGINEER 0 yes / 6 other
National Council For Behavioral Health 7 $3,803 6 6 0% DC CRM Developer II; Senior CRM Developer; Dynamics CRM Web Developer 0 yes / 6 other
Mi9 1 $3,238 6 6 33.3% TXILFL Software Quality Assurance Engineers and Testers; Data Analyst; Software Engineer; Sr. SQL Database Administrator; DevOps Engineer 0 yes / 6 other
La Magna Health Pllc 5 $2,265 6 6 100% TX Physician - Internal Medicine Hospitalist 0 yes / 6 other
John Wiley And Sons Inc 1 $1,000 6 6 0% NJ COMPUTER PROGRAMMER 2; Architect; Analyst - Testing 6 yes / 0 other
Transfinder Corporation 1 $995 6 6 0% NY Quality Assurance Engineer; GIS Software Engineer; Sr. Quality Assurance Engineer; Software Developer 0 yes / 6 other
National Dentex Corporation 3 $467 6 6 0% MN Developer, Data Warehouse; IT SECURITY ANALYST 0 yes / 6 other
Bansar Technologies Inc 350 $10,438,826 5 5 40% AZTX 0 yes / 5 other
Huitt-Zollars Inc 94 $5,130,981 5 5 0% AZ Civil Engineer; Civil Engineering Intern; Civil Engineer/Hydrologist 0 yes / 5 other
Antea Usa Inc 14 $4,347,854 5 5 40% CACOTX Senior Project Manager; Project Manager 0 yes / 5 other
Carahsoft Technology Corporation 97 $2,839,946 5 5 0% VA Computer Network Support Specialist; Computer Programmer 0 yes / 5 other
Harris County 8 $1,689,173 5 5 100% TX PEOPLESOFT CONSULTANT; PROCUREMENT DATA SCIENTIST; ASSISTANT DIRECTOR, PROJECT MANAGEMENT; PATHOLOGY POST DOC FELLOW; SENIOR PROGRAM MANAGER DATA ANALYTICS 1 yes / 4 other
University Of Texas Rio Grande Valley 51 $1,340,342 5 5 100% TX ASSISTANT PROFESSOR 0 yes / 5 other
Carahsoft Technology Corp 30 $1,271,600 5 5 0% VA Computer Network Support Specialist; Computer Programmer 0 yes / 5 other
Cloud Consulting Services Inc 55 $1,163,108 5 5 0% COWISC Software Developer; Database Developer 0 yes / 5 other
Helen Farabee Centers 10 $502,305 5 5 100% TX Crisis Case Manager; Mental Health Case Manager; Crisis Relapse Prevention/Follow Up Case Manager 0 yes / 5 other
Tri-County Behavioral Healthcare 2 $478,257 5 5 100% TX Psychiatrist; Child and Youth School Based Therapist; CHILD & YOUTH MENTAL HEALTH SPECIALIST 0 yes / 5 other
Structural Engineering Associates Inc 5 $454,155 5 5 100% TX Project Engineer; Structural Design Engineer 0 yes / 5 other
Vector Consulting Inc 10 $384,842 5 5 0% PACAGA Mechanical Engineer; IT/FileNet/Java Developer; Senior Cognos Developer/Architect; Software Developer 0 yes / 5 other
Aequor Healthcare Services Llc 55 $350,869 5 5 0% NJCA Accountant; Senior Network and Database Administrator; Medical and Health Services Managers 0 yes / 5 other
Lamar State College Port Arthur 23 $206,118 5 5 100% TX Athletic Trainer - Fitness Coordinator; Athletic Trainer Fitness Coordinator 0 yes / 5 other
Cameron County 1 $113,587 5 9 100% TX Law Clerk; Legal Research Clerk; Lawyer 0 yes / 5 other
Buchanan Technologies Inc 12 $104,280 5 5 40% MATX Business Analyst; IT ERP Functional Architect 0 yes / 5 other
Butler Snow Llp 7 $101,056 5 5 0% MS Attorney 0 yes / 5 other
Stevens Technical Services Inc 6 $84,974 5 5 100% TX Assistant Project Manager; Graduate Engineer; Trainee Engineer 0 yes / 5 other
Transworld Systems Inc 4 $79,300 5 5 0% VAILMA Senior Director, Corporate Strategy; Senior Network Engineer; Analyst Programmer 0 yes / 5 other
Dekker Perich Sabatini Llc 6 $43,953 5 5 0% AZNM Intern Architect; Design Associate 0 yes / 5 other
Weston Solutions Inc 2 $28,300 5 5 100% TX Project Manager; Analyst (GIS/Data) III 0 yes / 5 other
Abel Noser Solutions 2 $19,950 5 5 0% NY System Administrator; Strat Developer; Senior Vice President-Client Services And Data Analytics; Software Developer Associate 0 yes / 5 other
Texas Water Development Board 2 $12,652 5 5 100% TX Engineering Review Manager (Manager IV); Snowflake Developer; Project Manager; Engineering Reviewer (Project Manager I) 2 yes / 3 other
Hotel Engine Inc 12 $7,383 5 5 0% WACA Director AI Labs; Senior Manager, Supply Program Operations (Last Mile) 0 yes / 5 other
Clinics Of North Texas Llp 4 $3,037 5 5 100% TX Medical Technologist; Medical Lab Technologist 0 yes / 5 other
Methodist Physician Practices Pllc 7 $2,183 5 5 100% TX Physician (Cardiologist); Physician (Pediatric Cardiac Intensivist); Physician (General Surgeon) 0 yes / 5 other
Symphony Diagnostic Services No 1 Llc 1 $729 5 5 0% MOMD Sr. Enterprise Data Warehouse Developer/Analyst; Senior Database Administrator 0 yes / 5 other
Comanche County Medical Center Company 2 $228 5 5 100% TX Medical Technologist; MEDICAL TECHNOLOGIST 0 yes / 5 other
Austin Kidney Associates Pa 1 $200 5 5 100% TX Practice Physician (Nephrology) 0 yes / 5 other
Entech Civil Engineers Inc 62 $5,818,061 4 4 100% TX Graduate Engineer; Engineer in Training II; Bridge Project Engineer; Bridge Engineer-in-Training 0 yes / 4 other
Ernst & Young Us Llp 9 $1,068,221 4 40 50% TXIN SENIOR SOFTWARE DEVELOPER; ADVANCED SOFTWARE DEVELOPER 0 yes / 4 other
Houston Isd 2 $880,168 4 4 100% TX Software Application Developer 4 yes / 0 other
Kitchell Cem Inc 6 $625,939 4 4 0% CA Project Manager II; Project Manager I; Senior Project Engineer 0 yes / 4 other
Albourne America Llc 10 $561,748 4 4 0% CT Private Markets IDD Associate Analyst (Real Assets) 0 yes / 4 other
Integrateus Llc 33 $537,399 4 4 100% TX DATA SCIENTIST; FULL-STACK ENGINEER; FRONTEND WEB ENGINEER; ML ENGINEER 0 yes / 4 other
University Of North Texas System 3 $511,439 4 4 100% TX Senior Reporting Analyst; Reporting Analyst 0 yes / 4 other
Agha Engineering Llc 6 $403,681 4 4 100% TX Project Engineer; GIS Technician 0 yes / 4 other
Janus Research Group Llc 28 $396,285 4 4 0% MA Senior Research Associate I; Staff Scientist I 0 yes / 4 other
Learning Ally Inc 6 $350,208 4 4 0% NJ Senior Data Scientist; Data Scientist 0 yes / 4 other
Kroll Government Solutions Llc 6 $313,022 4 4 25% CATX Data Analyst, Kroll Government Solutions; Senior Software Engineer 0 yes / 4 other
Eastern Research Group Inc 19 $287,027 4 4 0% NCMAMI METROLOGY ENGINEER; ENVIRONMENTAL ANALYST; DATA ANALYST 0 yes / 4 other
Chapman And Cutler Llp 4 $149,883 4 4 0% ILNY Practice Management Specialist; Attorney 0 yes / 4 other
Stratus Team Llc 10 $107,606 4 4 0% FL Designer 0 yes / 4 other
Texas Higher Education Coordinating Board 1 $25,000 4 4 100% TX Junior Data Engineer; Software Developer 1 yes / 3 other
Familia Dental Midland Pllc 7 $17,711 4 4 100% TX General Dentist 0 yes / 4 other
Midway Independent School District 1 $14,205 4 4 100% TX Technology Education Teacher; Special Education Resource Teacher 0 yes / 4 other
United Veterinary Care Tx Pllc 1 $8,039 4 4 100% TX Veterinarian; Veterinary Technologist; Associate Veterinarian 0 yes / 4 other
Community First Health Plans Inc 1 $4,708 4 31 100% TX ADVANCED SOFTWARE DEVELOPER; SENIOR SOFTWARE DEVELOPER; QA Automation Engineer 1 yes / 3 other
Conference Of State Bank Supervisors 4 $3,765 4 4 0% DC Product Director, Research & Analytics; Business Analyst 0 yes / 4 other
Taylor Engineering Inc 1 $3,552 4 4 0% FLCA Mechanical Engineer; Water Resources Engineer; Coastal Engineer 0 yes / 4 other
Dbr Engineering Consultants Inc 3 $3,284 4 4 100% TX Business Operations Administrator; Senior Plumbing Designer Leader/Associate; Electrical Engineer 0 yes / 4 other
Tejano Center For Community Concerns Inc 1 $2,960 4 4 100% TX MATHEMATICS TEACHER; BILINGUAL TEACHER 0 yes / 4 other
Hec Software Inc 1 $2,700 4 4 0% UT International Business Development Manager; Data Analyst; Business and Marketing Data Analyst 0 yes / 4 other
Foundation For Cognitive Therapy And Research 2 $2,526 4 4 0% PA Research Coordinator; Assistant Director of CBT Programs 0 yes / 4 other
National Association Of Insurance Commissioners 1 $1,000 4 4 0% MO Senior JIRA Administrator 0 yes / 4 other
Oakbend Medical Center 3 $866 4 4 100% TX Staff Physician 0 yes / 4 other
Government Finance Officers Association 2 $710 4 4 0% IL Consultant Analyst 0 yes / 4 other
Straightline Medical Consultants Pa 4 $313 4 4 100% TX ATTENDING NEPHROLOGIST 0 yes / 4 other
Gastroenterology Consultants Of South Texas Pllc 1 $164 4 4 100% TX Physician Assistant 0 yes / 4 other
Confidential 584 $24,966,228 3 3 66.7% TXIN Financial and Investment Analysts - KBGFJG97500-15; Assistant Engineer 0 yes / 3 other
Cyclomedia Technology Inc 3 $7,005,631 3 3 0% WI Machine Learning Software Developer 0 yes / 3 other
Safal Partners Llc 6 $6,445,620 3 3 100% TX DATA ANALYST 0 yes / 3 other
Management & Training Corporation 7 $4,852,481 3 3 0% UT Oracle Specialist - ERP; Java Developer; Director, Corrections 0 yes / 3 other
Communities Foundation Of Texas Inc 6 $2,720,394 3 3 100% TX Director, Data Management & Analytics; Deputy Director 0 yes / 3 other
Gauge Engineering Llc 33 $1,766,655 3 3 100% TX Project Engineer; ENGINEER 1; Engineer I 0 yes / 3 other
Bartlett & West Inc 22 $1,447,225 3 3 0% ILKS PROJECT ENGINEER; SR. PROJECT ENGINEER (CHEMICAL ENGINEER) 0 yes / 3 other
Sourcepulse Llc 33 $1,389,242 3 3 100% TX Software Developer Analyst; Software Developer 0 yes / 3 other
Csg Government Solutions Inc 3 $890,910 3 3 0% IL Principal/Senior Technical Analyst 0 yes / 3 other
Dallas County 4 $876,241 3 3 100% TX Caseworker; NETWORK ENGINEER 1 yes / 2 other
University Of North Texas At Dallas 41 $835,416 3 3 100% TX Lecturer of Child Development and Family Studies; Lecturer 0 yes / 3 other
Epiq Ediscovery Solutions Inc 6 $666,076 3 3 0% WANYKS Client Services Associate Project Manager; Product Owner; Salesforce Developer 0 yes / 3 other
Winstead Pc 8 $505,057 3 3 100% TX Business Analyst; Associate Attorney 0 yes / 3 other
City Of Houston 5 $503,737 3 3 100% TX SENIOR STAFF ANALYST (SENIOR AVAIATION ANALYST); GIS Analyst 0 yes / 3 other
Favorite Healthcare Staffing Inc 53 $465,469 3 3 0% NJMI Registered Nurse 0 yes / 3 other
Apptricity Corporation 1 $350,000 3 3 66.7% TXCA Mobile Developer 0 yes / 3 other
Seiler Lankes Group Llc 5 $233,335 3 3 100% TX Engineer In Training 0 yes / 3 other
Enchoice Inc 8 $205,068 3 3 0% GA Senior Application Engineer 0 yes / 3 other
Nv5 Geospatial Inc 2 $153,690 3 3 33.3% ORTX Lidar Senior Analyst; DevOps Engineer 0 yes / 3 other
Sunland Group Inc 7 $142,090 3 3 100% TX Cost Engineer; Civil Engineer 0 yes / 3 other
Foster Garvey Pc 12 $136,597 3 3 0% NY Attorney 0 yes / 3 other
Harlandale Isd 1 $129,498 3 3 100% TX Teacher 0 yes / 3 other
City Of Abilene Texas 2 $120,092 3 3 100% TX 0 yes / 3 other
Enacomm Inc 6 $114,390 3 3 0% OK SENIOR IVR DEVELOPER; BUSINESS INTELLIGENCE ANALYST 0 yes / 3 other
Tyler Family Circle Of Care 1 $100,000 3 3 100% TX Pediatrician 0 yes / 3 other
Central Texas Community Health Centers 1 $100,000 3 3 100% TX Advanced Practice Provider; Pediatric Dentist 0 yes / 3 other
Apfs Staffing Inc 26 $96,822 3 3 0% MACT FINANCIAL ANALYST (FA), FINANCE AND OPERATIONS; Senior Software Engineer; Financial Analyst (FA), Finance and Operations 0 yes / 3 other
Microassist Inc 15 $73,658 3 3 100% TX DATABASE ADMINISTRATOR 0 yes / 3 other
Clint Independent School District 2 $65,188 3 3 100% TX Athletic Trainer; Teacher 0 yes / 3 other
Gabriel Roeder Smith & Company 3 $59,643 3 3 0% ILMI Senior Analyst; Actuarial Analyst 0 yes / 3 other
Summus Industries Inc 4 $49,407 3 3 100% TX Data Analyst, Accounts, Technology; DATA ANALYST, ACCOUNTS, TECHNOLOGY; Account Executive 0 yes / 3 other
Kemco Systems Co Llc 2 $34,172 3 3 0% FL Staff Manufacturing Engineer; Project Manager 0 yes / 3 other
Texas Southern University 1 $30,943 3 3 100% TX Executive Director for Strategic Partnerships & Academic Adv 0 yes / 3 other
Society For Human Resource Management 27 $25,982 3 3 0% VA Database Architect 0 yes / 3 other
Standard And Poors 1 $25,500 3 3 0% NY Automation Lead 3 yes / 0 other
The Chadwell Group Lp 2 $24,892 3 3 100% TX Construction Services Manager 0 yes / 3 other
Kudelski Security Inc 1 $9,750 3 3 100% TX 0 yes / 3 other
Edge Engineering Pllc 1 $9,216 3 3 100% TX EIT (ENGINEERING-IN-TRAINING); PROJECT MANAGER 0 yes / 3 other
Global Knowledge Training Llc 3 $7,694 3 3 0% NC ORACLE DEVELOPER; DATA SCIENTIST 0 yes / 3 other
Microassist 1 $7,500 3 3 100% TX DATABASE ADMINISTRATOR 0 yes / 3 other
Powergem Llc 1 $7,000 3 3 0% AL Consultant; Optimization Engineer; Software Engineer 0 yes / 3 other
Singleton Associates Pa 13 $6,726 3 3 66.7% TXAL Physician; Radiologist 0 yes / 3 other
Mercer 1 $5,500 3 3 0% MANJ COMPUTER SYSTEMS ANALYST; Custom Software Engineering Manager; Consulting Technical Director 1 yes / 2 other
The Cbord Group Inc 1 $1,875 3 3 0% GA Quality Assurance Engineer; Advisory Software Engineer 0 yes / 3 other
Eckerd College Inc 1 $1,350 3 3 0% FL Assistant Professor of Mathematics; Assistant Professor of Animal Studies 0 yes / 3 other
Texas Digestive Disease Consultants Pa 2 $1,059 3 3 0% CTWA Gastroenterologist 0 yes / 3 other
Hillcrest Baptist Medical Center 1 $290 3 3 100% TX Med Scientist 2 0 yes / 3 other
Texas Department Of Insurance 4 $240 3 3 100% TX Network Administrator; Data Analyst V; Data Analyst 0 yes / 3 other
Ophthalmic Consultants Of Texas Pa 1 $71 3 3 100% TX Ophthalmologist 0 yes / 3 other
Bge Inc 106 $23,048,171 2 2 0% IL Sr. Technical Lead; Senior Technical Lead 0 yes / 2 other
Dccm Infrastructure Inc 47 $5,158,748 2 2 100% TX Travel Demand Modeler 0 yes / 2 other
Myers And Stauffer Lc 9 $2,747,744 2 2 0% IN Senior Developer 0 yes / 2 other
Bridgefarmer & Associates Inc 15 $1,743,648 2 2 0% AR Civil Engineer 0 yes / 2 other
Amer Technology Inc 68 $1,607,900 2 2 100% TX Business Development Manager; Software Engineer 0 yes / 2 other
Bdo Government Services Llc 2 $1,603,200 2 2 100% TX Manager, Business Analyst 0 yes / 2 other
Sek Engineering Corp 9 $1,533,417 2 2 100% TX CIVIL DESIGN ENGINEER 0 yes / 2 other
Esp Associates Inc 22 $1,295,724 2 2 50% TXNC Engineer in Training; APPLICATIONS DEVELOPER 0 yes / 2 other
Ten Eyck Landscape Architects Inc 7 $1,167,588 2 2 100% TX Landscape Architect 0 yes / 2 other
Infrastructure Consulting & Engineering Llc 19 $998,214 2 2 100% TX Vice President - Texas Construction Services 0 yes / 2 other
Gov2biz Inc 13 $861,598 2 2 100% TX Software Engineer 0 yes / 2 other
Netsync Network Solutions 9 $639,630 2 2 100% TX Network Engineer; Network Architect 0 yes / 2 other
Schnabel Engineering Llc 7 $631,970 2 2 0% NYMD Project Engineer; Staff Engineer 0 yes / 2 other
Treanorhl Inc 29 $582,704 2 2 50% TXCA Associate Principal; Architectural Designer 0 yes / 2 other
O'Connell Robertson & Associates Inc 17 $519,753 2 2 100% TX Project Architect 0 yes / 2 other
Centers For Medicare And Medicaid Services 1 $474,877 2 2 0% VA Software Engineer 0 yes / 2 other
Amergis Healthcare Staffing Inc 67 $398,251 2 2 0% MD Software Development Engineer II 0 yes / 2 other
Shc Services Inc 80 $349,590 2 2 0% MD Speech-Language Pathologist (SLP) 0 yes / 2 other
Kinetech Cloud Llc 2 $276,918 2 2 100% TX BUSINESS ENGINEER - INTEGRATION ARCHITECT 0 yes / 2 other
Texas A & M University 2 $273,205 2 2 100% TX VISITING ASSISTANT PROFESSOR 0 yes / 2 other
J T Vaughn Construction Llc 6 $198,641 2 2 100% TX Assistant Project Manager 0 yes / 2 other
Thompson Coburn Llp 6 $163,814 2 2 0% NYMO Associate Attorney 0 yes / 2 other
Camino Real Community Mhmr Center 8 $157,831 2 2 100% TX Associate Psychologist 0 yes / 2 other
Gateway Community Health Center Inc 7 $141,370 2 2 100% TX Pediatrician 0 yes / 2 other
Rpd Systems Llc 7 $133,784 2 2 100% TX Drupal Developer 0 yes / 2 other
International Projects Consultancy Services Inc 8 $120,242 2 2 0% MNAL Security Architect; Systems Administrator 0 yes / 2 other
Infrastructure Associates Inc 19 $108,536 2 2 100% TX Mechanical Designer; MECHANICAL DESIGN ENGINEER 0 yes / 2 other
Troutman Pepper Locke Llp 2 $101,575 2 2 0% DC Associate 0 yes / 2 other
Health Services Of North Texas Inc 1 $100,000 2 2 100% TX Pediatrician 0 yes / 2 other
Fort Bend Family Health Center Inc 1 $100,000 2 2 100% TX CHIEF OPERATING OFFICER; Chief Population Health Officer 0 yes / 2 other
Federal Highway Administration 3 $86,700 2 2 0% VA Software Engineer 0 yes / 2 other
Cbiz Risk & Advisory Services Llc 3 $80,000 2 2 0% PA Senior Consultant; CBIZ Risk & Advisory Services LLC 0 yes / 2 other
Genesis Systems Inc 12 $60,702 2 2 0% FL Chief Technology Officer 0 yes / 2 other
Ferrilli 7 $60,333 2 2 50% TXNM Consultant; Application Support Specialist 0 yes / 2 other
Outreach Strategists Llc 2 $53,496 2 2 100% TX Counsel and Managing Director International Public Affairs; Counsel 0 yes / 2 other
Collier Consulting Inc 2 $42,926 2 2 100% TX Civil Engineer 0 yes / 2 other
Netsync Network Solutions Inc 4 $36,998 2 2 100% TX Network Engineer; Network Architect 0 yes / 2 other
City Of Midland 1 $33,185 2 2 100% TX Airport Operations Agent 0 yes / 2 other
Grayson College 1 $28,000 2 2 100% TX STATISTICIAN 0 yes / 2 other
Slingshot Llc 1 $24,300 2 2 0% NM Full Stack Developer; Full Stack Web Developer 0 yes / 2 other
Siteimprove Inc 2 $23,485 2 2 0% WA Principal Product Manager; Senior/Principal Product Manager 0 yes / 2 other
Etmc Physician Group Inc 21 $23,068 2 2 100% TX Family Medicine Physician 0 yes / 2 other
Agcm Inc 3 $20,603 2 2 100% TX Project Manager - Architectural 0 yes / 2 other
President And Fellows Of Harvard College 1 $17,900 2 2 0% MA Director, R&D Biomedical Engineering 0 yes / 2 other
Bluefin Llc 1 $16,440 2 2 0% CO Civil Engineer 0 yes / 2 other
Ector County 1 $16,098 2 2 100% TX Sanitarian 0 yes / 2 other
Inficare Health Inc 3 $13,443 2 2 0% VA Project Management Specialist - SaaS Products; Project Management Specialist - NFP SaaS Products 0 yes / 2 other
Radiology Associates Of North Texas Pa 36 $12,752 2 2 100% TX Pediatric Radiologist 0 yes / 2 other
Fittz & Shipman Inc 2 $9,226 2 2 100% TX STRUCTURAL ENGINEER II; Structural Engineer II 0 yes / 2 other
Therapy And Counseling Services Pllc 2 $8,025 2 2 0% PA Occupational Therapist 0 yes / 2 other
South Limestone Hospital District 3 $5,341 2 2 100% TX Family Medicine Physician 0 yes / 2 other
American Concrete Institute 2 $4,982 2 2 0% MI Engineer, Professional Development; Technical Director 0 yes / 2 other
Seton Family Of Doctors 4 $3,940 2 2 100% TX Physician (Vascular Neurologist) 0 yes / 2 other
Legacy Engineering Group Pllc 2 $2,777 2 2 100% TX Transportation Engineer (Engineer-In-Training); Transportation Engineer 16393-22 0 yes / 2 other
Pye-Barker Fire & Safety Llc 3 $2,690 2 2 50% TXFL APPLICATION PROGRAMMER ANALYST; Fire Sprinkler Designer 1 yes / 1 other
Lamar Institute Of Technology 1 $2,652 2 2 100% TX Instructor; Programmer III 0 yes / 2 other
High Q Llc 1 $2,500 2 2 0% VA Research Specialist; Cloud Architect 0 yes / 2 other
Sound Physicians Anesthesiology Of Texas Pllc 1 $1,018 2 2 100% TX Anesthesiologist 0 yes / 2 other
Dispute Resolution Center 1 $950 2 2 0% MN Mediation Manager; Mediation Coordinator 0 yes / 2 other
Vaisala Inc 1 $730 2 2 0% COWA Software Test Lead; Data Scientist 0 yes / 2 other
Aoka Engineering Llc 1 $720 2 2 100% TX Software Developer; Senior Software Developer 0 yes / 2 other
Momentive Software Inc 1 $449 2 2 0% GAFL Engineering Team Manager; Associate Development Manager 0 yes / 2 other
Raptor Technologies Llc 1 $150 2 2 0% NY Product Designer 0 yes / 2 other
Med Southwest Pllc 2 $115 2 2 0% OK OPTOMETRIST 0 yes / 2 other
Cozzini Bros Inc 3 $102 2 2 0% IL SENIOR DATA ANALYST; DATA ANALYST 0 yes / 2 other
Southwest Medical Imaging Inc 1 $95 2 2 0% AZ Data Scientist 0 yes / 2 other
Luna Data Solutions Inc 119 $8,053,919 1 1 100% TX Senior Software Developer 0 yes / 1 other
The Harris Center For Mental Health And Idd 22 $5,701,900 1 1 100% TX Health Analytics Analyst III 0 yes / 1 other
Sam Construction Services Inc 43 $5,421,414 1 1 100% TX Field Engineer 0 yes / 1 other
E-Consulting Inc 100 $3,688,552 1 1 100% TX Developer / Programmer Analyst 0 yes / 1 other
Freese & Nichols Inc 119 $3,629,350 1 1 100% TX Engineer IV 0 yes / 1 other
Texas A&M University Health Science Center 7 $3,551,557 1 1 100% TX Research Associate 0 yes / 1 other
University Of Texas System 72 $3,372,686 1 1 100% TX Senior Business-Analyst-HCM 0 yes / 1 other
Sjrc Texas Inc 7 $2,148,986 1 1 100% TX Kinship Specialist 0 yes / 1 other
Geotex Engineering Llc 17 $1,832,391 1 1 100% TX Geotechnical Engineer 0 yes / 1 other
Aguirre & Fields Lp 47 $1,764,674 1 1 100% TX GRADUATE ENGINEER 0 yes / 1 other
Tam Consulting Services Llc 14 $1,322,830 1 1 100% TX Sr. Project Manager 0 yes / 1 other
Phelps Dunbar Llp 9 $1,218,393 1 1 0% LA Business Intelligence Analyst 0 yes / 1 other
Lamb-Star Engineering Llc 14 $1,016,974 1 1 100% TX Engineer in Training I 0 yes / 1 other
Dunaway Associates Llc 5 $958,754 1 1 100% TX Senior GIS Analyst 0 yes / 1 other
Whitman Requardt And Associates Llp 5 $760,516 1 1 0% MD Geotechnical Engineer 0 yes / 1 other
Tryfacta Inc 37 $702,049 1 1 0% VA Senior Management Analyst 0 yes / 1 other
The Sanborn Map Company Inc 12 $620,940 1 1 0% WA Senior Vice President of Mapping Operations 0 yes / 1 other
Baker & Hostetler Llp 1 $586,821 1 1 0% DC Patent Technology Specialist 0 yes / 1 other
Amarillo Junior College District 35 $544,717 1 1 100% TX Faculty (Assistant Professor) Music 0 yes / 1 other
Foresight Planning & Engineering Services Llc 26 $542,626 1 1 100% TX Geotechnical Engineer 0 yes / 1 other
Prdg Llc 6 $382,170 1 1 100% TX Design Professional II 0 yes / 1 other
United Way Of San Antonio & Bexar County 5 $380,931 1 1 100% TX Impact Data Analyst 0 yes / 1 other
Meketa Investment Group Inc 2 $375,000 1 1 0% MA Full Stack Developer 0 yes / 1 other
Health Access Llc 5 $352,000 1 1 0% AZ Data Systems Epidemiologist 0 yes / 1 other
The Transtec Group Inc 7 $350,101 1 1 100% TX Project Engineer 0 yes / 1 other
All-Ways Engineering Llc 2 $345,835 1 1 100% TX Civil Engineer 0 yes / 1 other
C&T Consulting Services Llp 19 $315,411 1 1 100% TX IAM Solution Architect 0 yes / 1 other
Advanced Grc Inc 4 $245,500 1 1 0% NY Computer Programmer 0 yes / 1 other
Neubus Inc 20 $242,570 1 1 100% TX NLP Engineer 0 yes / 1 other
United Regional Health Care System Inc 11 $219,217 1 1 100% TX Radiological Technician 0 yes / 1 other
Crescens Inc 16 $214,936 1 1 0% CA Informatica MDM Architect 0 yes / 1 other
Institutional Shareholders Services Inc 1 $183,290 1 1 0% MD Senior Associate 0 yes / 1 other
University Of Texas Medical Branch At Galveston 4 $181,088 1 1 100% TX ASSISTANT PROFESSOR 0 yes / 1 other
Rps Infrastructure Inc 10 $167,326 1 1 100% TX Project Manager 0 yes / 1 other
City Of Waco 6 $118,854 1 1 100% TX Senior Epidemiologist 0 yes / 1 other
Ice Miller Llp 17 $110,903 1 1 0% OH Law Clerk 0 yes / 1 other
Jamail & Smith Construction Lp 1 $105,354 1 1 100% TX Construction Estimator 0 yes / 1 other
Tel/Logic Inc 2 $103,313 1 1 0% NY Business Development Specialist 0 yes / 1 other
Pricesenz 6 $100,763 1 1 100% TX Senior NodeJS Developer 0 yes / 1 other
Brownsville Community Health Clinic Corporation 1 $100,000 1 1 100% TX Internist 0 yes / 1 other
Atascosa Health Center Inc 1 $100,000 1 1 100% TX Internal Medicine Physician 0 yes / 1 other
Msm-Net Inc 6 $96,000 1 1 100% TX SOFTWARE DEVELOPER 0 yes / 1 other
V Group Inc 5 $93,496 1 1 0% NY Information Security Analyst 0 yes / 1 other
Allstem Connections Inc 17 $86,400 1 1 0% CA Instrumentation and Controls Engineering Professio 0 yes / 1 other
Tyler Regional Hospital Llc 6 $83,814 1 1 100% TX Athletic Trainer 0 yes / 1 other
Pricesenz Llc 6 $80,140 1 1 100% TX Senior NodeJS Developer 0 yes / 1 other
Pro Touch Nurses Inc 21 $50,201 1 1 100% TX Business Development Analyst 0 yes / 1 other
Yousuf Parekh Enterprises Inc 1 $45,511 1 1 100% TX Accountant 0 yes / 1 other
Ascension Seton 6 $39,849 1 1 100% TX Genetic Counselor 0 yes / 1 other
Pdg Inc 6 $33,463 1 1 0% MN DENTIST 0 yes / 1 other
Labware Inc 6 $33,000 1 1 0% DE Software Engineer-Test 0 yes / 1 other
Ogletree Deakins Nash Smoak & Stewart Pc 5 $28,166 1 1 0% GA International Practice Group Associate 0 yes / 1 other
Api Group Life Safety Usa Llc 2 $21,210 1 1 0% AZ Project Manager and Designer 0 yes / 1 other
Prosci Inc 4 $18,200 1 1 0% CA RESEARCH ASSOCIATE 0 yes / 1 other
Hagerty Consulting Inc 2 $17,840 1 1 0% NJ Senior Managing Associate (Operations) 0 yes / 1 other
Global Alumni Corp 1 $16,896 1 1 0% MA Risk Management Specialist 0 yes / 1 other
Compsych Corporation 4 $16,702 1 1 0% IL Senior Vice President of Operations 0 yes / 1 other
Innovative Advocate Group Inc 4 $14,971 1 1 0% NJ Data Scientist II 0 yes / 1 other
St David'S Medical Center 1 $14,824 1 1 100% TX Neurohospitalist 0 yes / 1 other
Kowert Hood Munyon Rankin & Goetzel P C 14 $13,547 1 1 100% TX Technical Adviser 0 yes / 1 other
Ensafe Inc 1 $12,309 1 1 100% TX Senior Compliance Engineer 0 yes / 1 other
Phamatech Inc 4 $12,038 1 1 0% CA Business Development Representative 0 yes / 1 other
Office Of The Governor 1 $12,000 1 1 100% TX Software Developer / Senior Consultant 1 yes / 0 other
E D Etnyre & Co 1 $12,000 1 1 0% AZ SENIOR DESIGN ENGINEER 1 yes / 0 other
Western States Fire Protection Co 1 $6,048 1 1 0% OK Design Manager 0 yes / 1 other
Harlingen Medical Center Lp 2 $5,206 1 1 100% TX RAC HEALTHCARE MANAGER 0 yes / 1 other
Np Strategies Llc 1 $5,000 1 1 100% TX AppSheet Developer 0 yes / 1 other
Pathology Associates Of San Antonio Llp 13 $4,238 1 1 100% TX Medical Doctor 0 yes / 1 other
Midland College 2 $3,670 1 1 100% TX Assistant Professor 0 yes / 1 other
Emergent Llc 1 $2,476 1 1 0% NY Market Research Analyst 0 yes / 1 other
Becker Professional Development Corporation 2 $2,448 1 1 0% NJ Sr. Analyst, Salesforce 0 yes / 1 other
Cgi Technologies & Solutions Inc 1 $1,960 1 1 0% SC Mainframe QA Tester 1 yes / 0 other
Oliver Street 5 01 A Inc 2 $1,452 1 1 100% TX Physician (Dermatology) 0 yes / 1 other
Crazy Egg Inc 1 $1,250 1 1 0% NJ UX Designer 0 yes / 1 other
Epic Transportation Group Lp 1 $1,055 1 1 100% TX Graduate Engineer 0 yes / 1 other
Texas State Library & Archives Commission 11 $999 1 1 100% TX PHP Developer / Programmer Analyst 3 1 yes / 0 other
Alchemer Llc 1 $863 1 1 0% WA Senior Data Analyst 0 yes / 1 other
Secretary Of State 26 $783 1 1 0% IL PROGRAMMER ANALYST 1 yes / 0 other
Compex Legal Services Inc 1 $757 1 1 0% CA SOFTWARE ENGINEER 0 yes / 1 other
Digi Security Systems Llc 1 $672 1 1 100% TX Lead Technician 0 yes / 1 other
Facility Interiors Inc 1 $600 1 1 100% TX Solutions Analyst 0 yes / 1 other
360training Com Inc 2 $600 1 1 100% TX Product Manager 0 yes / 1 other
Assetworks Inc 1 $535 1 1 100% TX Mobile Software Developer 0 yes / 1 other
Apc Health Llc 1 $84 1 1 100% TX Medical Laboratory Technologist 0 yes / 1 other
University Of Tx Med Branch At Galveston 4 $400,549,372
Accenture State Healthcare Services Llc 29 $134,202,327
University Of Texas At Austin 386 $65,040,233
Texas Vsi Llc 62 $46,409,686
University Of Texas Southwestern Medical Center At 81 $30,629,599
Ut Health Science Center At Houston 34 $26,780,076
Texas Division Of Emergency Management Revolving 10 $21,906,068
At&T 44 $21,268,705
Alamo Trust Inc 82 $17,903,155
Presidio Networked Solutions Group Llc 26 $16,902,011
Touchstone Veterans Management Ltd 48 $14,506,715
Neos Consulting Group Llc 246 $13,169,624
Nipun Systems Inc 358 $12,565,227
Montgomery County Texas 3 $11,949,830
Austin Travis County Mhmr Center 4 $11,680,400
Coastal Bend Bays & Estuaries Program Inc 18 $10,084,995
Texas A&M System Revolving 64 $9,895,365
Department Of State Health Services 12 $9,806,625
North Texas Behavioral Health Authority 15 $8,620,936
Bluebonnet Trails Community Mhmr Center 13 $8,596,364
Education Service Center Region 10 10 $8,535,040
Loblolly Consulting Llc 303 $8,435,784
Texas Govlink Inc 195 $8,103,518
Tntp Inc 41 $8,071,529
Gts Technology Solutions Inc 242 $8,007,175
Texas Facilities Commission 6 $7,920,891
Care Inns Of Texas 38 $7,715,624
Sistema Technologies Inc 118 $7,460,711
Insight Public Sector Inc 63 $7,444,396
Uthscsa 101 $6,813,344
Ut Health Center At Tyler 16 $6,785,024
Indelible It Advisory Solutions Llc 7 $6,605,482
Mhmr Tarrant County 2 $6,180,313
Stg International Inc 9 $5,800,203
Texas Dept Of Information Resources 38 $5,730,270
Dynamic Computing Services 42 $5,372,105
Pathway Services Inc 4 $5,140,381
Palestine Principle Healthcare Limited Partnership 6 $4,496,802
Strinteg Corporation 12 $4,273,210
Texas Family Initiative Llc 13 $4,181,833
Callan Marine Ltd 7 $4,121,382
Icf Consulting Group Inc 6 $4,026,239
Poznecki-Camarillo Llc 43 $3,866,252
C & T Information Technology Consulting Inc 185 $3,761,964
Brizo Construction Llc 5 $3,571,210
Dccm North America Llc 6 $3,570,233
The Estes Group Llc 24 $3,559,188
Srb Systems Inc 164 $3,544,952
Tropical Texas Behavioral Health 12 $3,444,715
Fis Fidelity National Information Services 6 $3,396,511
Critical Health Connection Llc 104 $3,362,613
University Of Texas At Galveston 16 $3,327,154
Disaster Services Corporation-Society Of St Vincen 11 $3,178,279
Ssdatainfo Inc 8 $2,880,563
Shi Government Solutions Inc 181 $2,839,981
Athomtech Inc 133 $2,804,426
Ducks Unlimited Inc 2 $2,775,582
University Of Texas M D Anderson Cancer Center 14 $2,753,117
Carahsoft Technolgy Corporation 26 $2,666,404
Marmon Mok Lp 14 $2,625,098
Pgal Inc 45 $2,522,103
Workquest-Temps 236 $2,405,852
Mjb Engineering Llc 7 $2,374,765
Rapisource Llc 79 $2,290,701
Arrb Group Inc 9 $2,261,873
Barnhart Constructors Inc 11 $2,253,892
Tom Green & Company Engineers Inc 22 $2,250,705
Asteria Learning Inc 11 $2,245,472
B2z Engineering Llc 23 $2,225,867
Teacher Retirement Investment Company Of Texas Ltd 13 $2,084,490
State Auditor'S Office 174 $2,075,609
Pmcs Services Inc 85 $2,038,279
Perimeter Behavioral Hospital Of Garland Llc 6 $2,034,000
Genius Road Llc 52 $2,013,722
Locum Tenens Com 68 $2,001,605
Chad Wright Engineering Llc 19 $1,973,417
At&T Mobility 8 $1,957,430
Our Community Our Kids 6 $1,934,465
Idemia Civil Identity Na Llc 6 $1,892,270
My Health My Resources Of Tarrant County 13 $1,866,129
Creative Enterprise Solutions Llc 5 $1,852,069
Emergence Health Network 8 $1,802,455
State Office Of Administrative Hearings 14 $1,774,473
Technology Consortium Llc 5 $1,746,896
Capitol Systems Inc 38 $1,745,388
The Center For Health Care Services 15 $1,697,891
Daman Consulting Inc 51 $1,693,578
Lmb Engineering Inc 10 $1,688,730
Arrati Inc 56 $1,654,375
Wps Engineering Llc 10 $1,576,535
U T Health Science Center At Houston 24 $1,569,982
Lonestar Program Controls Group Llc 12 $1,541,769
Dallas County Sheriff'S Dept 4 $1,538,343
Parkhill Smith & Cooper Inc 41 $1,518,231
Pcc Technology Inc Dba Civix 7 $1,518,218
Saint Francis Community Services In Texas Inc 7 $1,516,990
Public Catalyst Group Corp 6 $1,499,986
Deloitte Consulting Llp C/O Bank Of America 5 $1,498,841
Texas A&M University Revolving 82 $1,492,089
Landtech Inc 10 $1,482,242
Bexar County Board Of Trustees For Mhmr Services 11 $1,471,581
Sherry Matthews Inc 10 $1,466,189
Austin Travis Co Mhmr Center 1 $1,463,020
Mighty Citizen 13 $1,399,751
Hdi Solutions Llc 10 $1,387,771
Texas Engineering Extension Service 68 $1,383,956
Broaddus & Associates 9 $1,373,571
Kelmar Associates Llc 8 $1,350,803
University Of Texas Health Science Center At Houst 16 $1,339,181
Texas Appl-003 6 $1,298,992
4kids4families 7 $1,292,376
Energy Architecture Inc 7 $1,235,272
Plano Data A Record Management Company Lp 35 $1,223,248
Chandra Technologies Inc 59 $1,217,847
Scientech Engineers Inc 5 $1,214,116
Mckinney York Architects 17 $1,213,320
Usgb Llc D/B/A Us Gold Bureau 3 $1,203,537
Rudd & Wisdom Inc 28 $1,201,961
The Law Office Of Tory Vonder Haar 6 $1,189,058
Jjg Development Llc 10 $1,185,963
Matagorda County 3 $1,180,373
City Of Killeen 7 $1,155,606
Ibridge Group Inc 17 $1,143,105
N3vision Healthcare Enterprise Inc 6 $1,138,250
Access Innovation Partners Llc 7 $1,137,587
Elephant Productions Inc 6 $1,130,364
Hireblazer Llc 40 $1,122,988
Mkrdy San Antonio Ii Llc 2 $1,116,983
Unthsc@Fw 62 $1,116,460
Symbio Ecosystems Llc 17 $1,115,553
Aransas County 1 $1,107,333
Austin Community College District 37 $1,092,717
Abdeladim Llc 54 $1,089,361
Texas Asphalt Pavement Association 8 $1,089,350
At&T Corporation 6 $1,077,118
United Way Of Greater Houston 7 $1,076,814
Burgess & Niple Inc 6 $1,070,725
George Butler Associates Inc 9 $1,066,631
Ekhp Consulting Llc 56 $1,039,233
C & T Consulting Services Llp 37 $1,035,303
Austin Travis County Mhmr 5 $1,011,986
Proscalar Llc 4 $996,478
Burke Center 11 $993,535
Advance D Temporaries Inc 91 $982,904
James W Turner Construction Ltd 7 $979,658
Consilium Staffing Llc 39 $967,634
Seikosoft Llc 3 $967,492
Lakes Regional Mhmr Center 11 $961,916
Gartner Group 3 $959,117
Texas Alcohol & Drug Testing Service Inc 93 $954,021
Aksia Torreycove Partners Llc 2 $926,000
Ey Infrastructure Advisors Llc 8 $921,900
Texana Center 1 $921,512
Us Bank Corporate Payment Systems 491 $920,171
Andrews Center 9 $908,983
Pressley Ridge Texas 7 $904,662
Sms Ambulance Service Llc 6 $885,612
Alamo Area Council Of Governments 38 $883,995
White Hawk Engineering & Design Llc 6 $882,045
Versar Inc 10 $881,796
Dovenmuehle Mortgage Inc 5 $872,276
Orsat L L C 14 $865,434
Mckinsey & Company Inc Washington D C 2 $859,000
San Antonio Food Bank Inc 7 $858,247
M&E Consultants Llc 9 $856,529
Yvonne Newman Engineering Inc 5 $846,988
Geo Works International Inc 6 $845,657
Pacotech Inc 15 $844,651
Central Counties Center For Mhmr Services 12 $839,650
Allen & Company Environmental Services 4 $838,621
Heart Of Texas Behavioral Health Network 16 $836,815
Texas Health Services Authority 2 $828,500
Texas Council On Family Violence 6 $822,436
Jet Software Solutions Inc 31 $817,566
Ondaro Llc 9 $815,070
System 13 Inc 12 $811,203
Broaddus & Associates Inc 11 $810,243
Jim West Engineering Llc 4 $809,429
U S Geological Survey 8 $805,278
Community Council Of Greater Dallas Inc 15 $801,139
University Of Texas Health Science Center San 14 $792,325
Weaver & Tidwell Llp 46 $789,431
Texas Rural Water Association 7 $786,941
Cooper Consulting Company 45 $781,978
Rodriguez Transportation Group Inc 18 $781,651
Hill Country Mhdd Center 12 $776,766
Sabine Valley Regional Mhmr Center 5 $770,325
The Univ Of Tx Health Science Cntr At Houston 2 $757,219
Mitigate Texas Llc 4 $749,583
Region Xi Education Service Center 8 $734,852
Ars Engineers Inc 23 $729,510
Innovative Emergency Management Inc 2 $729,385
R2m Engineering Llc 7 $724,307
University Of Texas Health Science Center Sa 11 $714,488
Computer Technologies Usa Llc 6 $713,610
Baker Moran Doggett Ma & Dobbs Llp 5 $713,341
The Greentree Group Inc 10 $708,828
Prairie View A&M Unv State Scholarship Reimb 43 $702,714
Arcadis Usa Inc 19 $694,057
Beehive Specialty 5 $692,258
Brightleaf Group Inc 59 $683,634
Spindletop Mhmr Services 7 $670,861
Workquest 60 $667,368
Arredondo Zepeda & Brunz Llc 11 $667,000
Fort Worth I S D 1 $666,886
National Human Resource Group Inc 35 $666,524
Dallas College 2 $657,320
Elliott Bay Design Group Llc 11 $656,554
Blanton And Associates 29 $656,220
Cbk Computing Llc 23 $654,006
Panhandle Isd 9 $653,925
Advanced Call Center Technologies Llc 13 $653,203
Alamo City Engineers Llc 9 $649,743
Steel Digital Studios Inc 13 $647,283
Truepani Inc 7 $644,705
Dallas Metrocare Services 1 $640,057
Medical Edge Recruitment Llc 76 $633,277
Operator Xr Llc 2 $629,861
Southeast Texas Regional Planning Commission 38 $628,792
Friends Of The Texas Historical Commission Inc 2 $625,500
Ingenesis 11 $621,341
Sourcematch Inc 39 $620,339
Daman Consulting Incorporated 25 $613,485
Kta-Tator Inc 8 $608,570
Ut Health Science Center 1 $604,675
City Of Socorro 7 $602,293
Custom Healthcare Solutions Llc 52 $601,431
Region Iv Education Service Ctr 5 $600,250
Star Autism Support 2 $595,770
Dna Diagnostics Center Inc 6 $592,525
Gejits Infotech Inc 20 $591,966
Family Endeavors Inc 4 $591,801
Regents Of The Univ Of Ca-Cahfs 6 $591,350
Spurtech Consultants Inc 33 $586,565
24hournurse Llc 75 $584,003
Region I Education Service Center 7 $580,280
Dallas Isd 1 $578,275
Voluble Systems Llc 29 $574,602
Rawlins Infra Consult Llc 4 $570,000
Northside Isd 2 $563,444
Bontempo Structural Engineering Inc 2 $551,861
Telus Health (Us) Ltd 3 $545,514
Texana Mhmr Center 13 $535,706
Jose I Guerra Inc 16 $532,375
Tri County Mhmr Services 7 $532,135
Quest Diagnostics Clinical Laboratories Inc 13 $526,455
Feeding Texas 9 $522,747
El Paso Metropolitan Planning Organization 2 $522,025
Knause Consulting Group Llc 34 $520,587
Learning Tree International Usa Inc 43 $511,156
City Of Lubbock 6 $509,709
Border Region Mhmr Community Center 8 $503,101
Xpedient Technologies Llc 16 $502,415
Coastal Plains Community Center 13 $501,395
Dallas County Public Works 1 $500,780
City Of El Paso 15 $496,691
Daniel B Stephens & Associates Inc 17 $496,184
Summit Surveying Inc 13 $494,271
Tarrant County 1 $492,168
Department Of Family And Protective Services 6 $491,545
Rfd & Associates Inc 18 $485,444
Gge Design & Consulting Llc 5 $480,397
Coya Life Llc 3 $480,249
Region Xx Education Service Center 7 $479,894
United Way For Greater Austin 8 $479,451
Nueces Co Mhmr Community Center 8 $478,999
Spindletop Center 8 $473,375
University Of Texas Health Center At Tyler 16 $473,344
Everychild Inc 6 $463,494
Richter Associates Architects Inc 2 $457,638
Pasadena Isd 2 $449,592
Solaray Engineering Inc 16 $448,949
Baseline Corp 8 $440,470
The Gulf Coast Center 9 $437,791
Nepc Llc 2 $437,500
Vianovo Lp 12 $436,715
Texas A&M Victoria 5 $435,128
Texas A&M Galveston Revolving 13 $428,754
Qs Healthcare Llc 35 $427,619
Collin County Mental Health Mental Retardation Ctr 2 $427,012
Denton County Mhmr Center 10 $426,893
Rrp Consulting Engineers Llc 8 $425,613
Mtc Medical Llc 4 $424,583
U S Fish & Wildlife Service 6 $424,343
Collaborate Pm Llc 6 $412,128
Region Xiii Education Service Center 8 $408,400
Alliance Geotechnical Group Inc 8 $405,874
Jacksonville Hospital Llc 26 $400,189
Webmd Health Corp 4 $396,262
Goodman Classic Construction Inc 1 $394,619
Cbk Computing Group Llc 31 $393,588
Pecan Valley Mhmr Region 7 $392,881
Cotten/Landreth Architects Inc 29 $390,094
Epic Holdings Inc 24 $386,957
Thomson Reuters - West 11 $386,194
Texoma Community Center 9 $377,330
Heart Of Texas Region Mhmr Center 1 $376,080
Cooper & Kirk Pllc 5 $374,105
Michigan Peer Review Organization 11 $371,869
Katy Isd 2 $363,985
Aquila Commercial Llc 3 $362,973
Texas Panhandle Mental Health Mental Retardation 13 $362,260
Spring Branch Community Health Center 8 $355,291
Trb Capital Markets Llc 6 $354,327
Vhs Harlingen Hospital Company Llc 4 $353,219
Infostride Inc 27 $352,043
Danielle Skidmore Consulting Pllc 7 $349,899
Austin I S D 1 $349,204
Kemp Smith Llp 14 $348,606
Eea-Command Commissioning Jv 2 $346,500
Cypress-Fairbanks Isd 2 $345,385
Pharr-San Juan-Alamo Isd 3 $345,364
Betty Hardwick Center Mh/Mr 8 $344,536
E3 Entegral Solutions 1 $343,919
Texas A&M Health Science Center Revolving 64 $340,226
Houston Area Community Services Inc 8 $338,867
Prolim Global Corporatioon 20 $337,132
Gorrondona & Associates Inc 11 $336,906
Fort Bend Isd 2 $336,538
Suitemate Staffing Solutions Inc 60 $334,261
Dynamic Computing Services (Dcs) Corp 16 $334,213
Garland Isd 2 $329,595
4 Consulting Inc 21 $329,009
Rsk Uk Limited 2 $328,700
Mhmr Services For The Concho Valley 9 $328,206
Square One Consultants Inc 11 $327,934
Deer Oaks Eap Services Llc 94 $327,434
Flightsafety Textron Aviation Training Llc 5 $326,600
Longview Wellness Center Inc 2 $325,000
Bee Busy Wellness Center 2 $325,000
Healing Hands Ministries Inc 2 $325,000
Tomagwa Ministries Inc 2 $325,000
Community Advocacy Research And Evaluation Consult 6 $324,638
Nueces County Auditor'S Office 4 $315,000
Siegfried Engineering & Construction Llc 8 $314,367
Adjacent Technologies Inc 8 $314,200
Anderson/Cherokee Counties Enrichment Services 8 $314,089
Rhyan Technology Services Llc 5 $312,800
Marathon Construction Estimating Llc 13 $312,400
Connected Health Care Llc 57 $312,345
Texas A&M University Central Texas_Revolving 18 $311,897
Central Texas Food Bank Inc 9 $310,311
University Of Texas At Tyler 15 $305,881
Amarillo Independent School District 2 $303,368
Cascade Civil Services Llc 6 $303,033
Health Strategy Llc 12 $300,000
Texas Pharmacy Association 24 $297,444
West Texas Centers For Mhmr 9 $295,202
Ondata Inc 24 $295,095
Esa Enterprise Staffing Agency Llc 55 $292,963
Jackson Walker Llp 43 $292,667
1836 Engineering Llc 6 $288,326
Rods Inc 2 $287,718
Baker Tilly Advisory Group Parent Lp 6 $284,681
Elements Of Architecture Inc 51 $284,648
Fisher Enterprises Ltd 2 $283,200
Community Council Of The Rio Grande Valley 5 $282,683
Negrete & Kolar Architects 2 $282,560
Camino Real Community Services 1 $281,129
Camino Real Regional Mobility Authority 10 $280,848
Texas A & M Univ System Administration 1 $280,032
Dsw Homes Llc 3 $279,114
City Of Abilene 4 $278,608
Hillday Public Relations Inc 4 $278,077
Segal Company (Southeast) Inc 14 $277,214
Mcgray & Mcgray Land Surveyors Inc 2 $275,977
Texas State Technical College 20 $275,687
Geocomm Inc 6 $273,379
The Iq Business Group Inc 9 $268,873
San Antonio Isd 2 $266,687
City Of Mission 2 $266,664
Conroe Isd 2 $266,263
Heart Of Texas Council Of Governments 31 $266,165
Ducky Johnson Home Elevation Llc 2 $263,728
Apollo Environmental Strategies Inc 1 $261,250
Usda-Nfc-Fmmi Cod Collections 1 $260,000
Caduceus 16 $257,011
Envision Water Llc Dba Envision Water 3 $256,788
Survtex Llc 1 $256,441
The Univ Of Texas Medical Branch At Galveston 4 $254,726
Ea Engineering Science And Technology 7 $250,341
Humble Isd 2 $249,708
Texoma Council Of Governments 27 $247,520
Alief Isd 12 $246,804
Mesa Integrated Solutions Inc 8 $246,800
Casey Garrett 3 $245,655
Mhmr Authority Of Brazos Valley 2 $245,286
Nueces County Mhmr Community Center 11 $244,437
Quiddity Engineering Llc 15 $243,030
Gabriel Roeder Smith And Company 3 $241,718
The Rios Group Inc 29 $240,426
Flores Geotechnical Llc 7 $239,735
Jams Inc 4 $238,708
Secord & Lebow Architects Llp 8 $237,206
Houston Food Bank 4 $237,157
Gulf Bend Mh Mr Center 1 $235,638
Hidalgo County 1 $235,529
South Plains Association Of Governments 30 $235,474
Rv Kuhns & Associates Inc Dba Rvk Inc 2 $235,000
Sanderson Surveying Inc 1 $234,510
Berry Dunn Mcneil & Parker Llc 1 $232,985
Gulf Bend Mhmr Center 9 $232,454
Harvest Time Farms Inc 1 $231,624
Abacus Technical Srvs Llc Dba Talent Groups 24 $229,417
Roc Search 5 $229,067
Mhmra Of Brazos Valley 9 $226,446
Gov Guru Llc 16 $224,862
Vinson And Elkins Llp 6 $223,427
Sadler Law Group Pllc 4 $222,924
United Way Of Amarillo & Canyon 5 $221,174
Bickerstaff Heath Delgado Acosta Llp 28 $220,834
Pen-Link Ltd 1 $220,742
Morris & Associates Engineers Inc 6 $220,168
Estrategy Solutions Inc 12 $219,064
Johnston Llc 12 $214,608
Mathew Pidathala Dba Tekwings Llc 22 $213,702
Rfd And Associates Inc 5 $212,298
Susswein Communications Llc 4 $211,745
Lindenwood Education System 26 $210,099
Zencon Group Inc 12 $208,929
University Of Texas Arlington 5 $208,826
The Shearer Group Inc 9 $208,354
Shaw Environmental Inc 10 $206,560
Environmental Research Group Llc 25 $205,995
Quality Response Medical Staffing Llc 43 $205,614
New Horizons Learning Llc 98 $205,531
Emdi Consult Inc 17 $203,818
Audit Services Us Llc 2 $203,303
Workers Assistance Program Inc 78 $201,908
Modus Ediscovery Inc 6 $200,810
Presidio Technology Capital Llc 1 $200,748
Thos S Byrne 7 $200,687
Frontera Healthcare Network 3 $200,000
Michael J Urban 15 $198,500
The North Highland Holding Company Llc 2 $197,600
Socorro Independent School District 2 $195,059
Optimum Consultancy Services Llc 13 $194,283
Intellectual Capitol Inc 13 $193,755
Collins Engineers Incorporated 3 $193,653
Nipun System Inc 18 $193,508
Bla Schwartz Pc 3 $193,334
Software One Inc 9 $193,000
Gain Innovation Llc 21 $192,916
Slg Millennium Group Llc 14 $192,757
General Healthcare Resources Llc 46 $192,060
International Association Of Fire Fighters 3 $192,000
Drc Construction Llc 2 $191,944
Stonewater Inc 2 $191,225
Salvador Baeza 10 $191,178
Computershare Trust Company Na 2 $189,045
Dutech Systems Inc 12 $188,929
Databank Imc Llc 6 $188,712
Priority Engineering Incorporated 6 $188,491
Castle Peak Advisors Llc 6 $187,500
Energy Engineering Associates Inc 25 $187,450
Michael Welch 9 $187,200
Lieb Management & Beteiligungs Gmbh 11 $187,145
Brownsville Independent School District 1 $186,951
Amn Healthcare Locum Tenens Inc 23 $186,749
Healthconnect Texas 3 $186,000
El Paso Public Schools 1 $183,393
Pillar Consulting Group Llc 10 $181,652
Teqsys Inc 8 $181,074
Healthcare For The Homeless-Houston 8 $180,074
United Way Of The Brazos Valley 6 $180,058
Cake Development Corporation 3 $180,000
United Way Of Smith County 6 $179,885
Eworld Infotech Llc 6 $178,735
Permian Basin Community Centers For Mental Health 1 $176,473
Discovery Audit Services Llc (Das) 6 $176,376
United Isd 2 $175,727
Spring Branch Isd 2 $175,202
Acusensus Inc 1 $175,000
On-Site Insight 6 $174,732
Us Army Corps Of Engineers 1 $172,090
Irving Isd 1 $171,838
Richardson Isd 2 $171,817
Inland Environments Ltd 1 $171,759
Region Vi Education Service Center 7 $169,800
Ksa Engineers 5 $169,189
Shine & Associates Inc 3 $168,178
Sigma Threat Management Llc 6 $168,000
United Way Of Abilene Inc 5 $167,955
Permian Basin Community Centers For Mhmr 9 $167,820
Mission Cisd 1 $167,736
Vox International Inc 8 $167,505
Freeit Data Solutions Inc 2 $166,200
Gsbs Batenhorst Inc 12 $166,063
Meadows Mental Health Policy Institute 5 $165,420
Johnson & Pace Incorporated 2 $164,100
Klein Isd 2 $163,192
United Way Of Central Texas 7 $162,847
Capital Area Council Of Governments 28 $162,197
Allterra Central Inc 1 $160,619
University Of Houston Splhrg 1 $160,551
Hopkins County Community Action Network 7 $157,911
Treasury Services Group Llc 3 $156,545
Database Projects Group Llc 3 $155,760
Weston Solution Inc 13 $155,600
Region Vii Education Service Center 6 $155,333
Ramesh Komaragiri Pllc 9 $155,276
Texas Archive Of The Moving Image 6 $154,998
Teg Technologies Llc 5 $154,735
Tekwings Llc 6 $153,472
Petrosys Solutions Inc 2 $152,750
Central Plains Center For Mental Health Mental Ret 1 $152,039
Vexterra Group Llc 1 $152,001
Exevision Inc 5 $151,523
Texas Wildlife Damage Management Association 6 $150,613
Sst Usa Inc 16 $150,300
United States Geological Survey 2 $150,000
College Advising Corps 1 $150,000
Resources For Learning Llc 15 $149,650
Thiel Desiggn Grop Llc 12 $149,593
Hutson Gallagher Inc 1 $149,273
School Of Pe Inc 5 $148,720
Solid Border Inc 4 $147,482
Gibson Dunn And Crutcher Llp 3 $145,605
Presbyterian Hospital Of Kaufman 17 $145,419
Lja Surveying Inc 6 $144,464
Cell Staff Llc 40 $144,280
Sequel Data Systems Inc 2 $143,958
Gti Tourism Pty Ltd 15 $143,341
Somach Simmons & Dunn 5 $142,514
Camacho Consulting Llc 8 $141,571
Vertosoft Llc 3 $141,415
Kindersystems Inc 2 $140,280
Elite Research Llc 6 $139,999
Aon Hewitt Investment 18 $139,998
Gateway First Bank 17 $139,550
Freese And Nichols - Ghd Joint Venture 6 $139,192
Pedigo Staffing Services Llc 14 $139,046
Texans Together Sscc 1 $139,019
Texas State University-San Marcos 4 $138,767
Redwood Toxicology Laboratory 26 $138,654
Leander Isd 2 $138,295
Golden Crescent Regional Planning Commission 30 $138,182
Guthrie Common School District 11 $138,110
Stephen F Austin Community Health Center Inc 11 $137,905
Deep East Texas Council Of Governments 27 $137,696
Texas Alcohol & Drug Testing Service 85 $137,581
Corpus Christi Isd 1 $137,340
Mccall Parkhurst & Horton Llp 12 $136,561
Underwood Drafting & Surveying Inc 3 $136,126
Mcci Llc 2 $136,072
Morrow Consulting Llc 2 $134,311
National Assoc Of State Boating Law Admin Inc 3 $134,220
Texas Engineering Experiment Station 8 $134,106
Talon Lpe Ltd 4 $133,747
North Central Texas Cog 23 $133,400
A-Line Staffing Solutions Llc 25 $133,097
Spinks Solutions Llc 3 $132,200
South Texas College 1 $130,866
Lucius D Bunton 6 $129,161
Judson Isd 2 $129,129
Concho Valley Council Of Governments 24 $129,041
Eea-Command Commissioning Llc 1 $127,967
Round Rock Ind School District 2 $127,143
Seneca Resources Llc 6 $126,768
Ksa Engineers Inc 4 $126,533
Aids Arms Inc 6 $126,502
Raba Kistner Consultants Inc 5 $125,744
Ysleta I S D 1 $125,215
Facility Programming Ltd 9 $124,760
Adelphi Staffing Llc 19 $124,000
Isphere Innovation Parterners 6 $123,969
Texas Historical Commission 1 $123,450
Momentum Search Partners Llc 2 $122,500
North Texas Area Community Health Centers Inc 7 $122,274
Fort Bend County 1 $121,545
Bennett Benner Partners Inc 8 $121,264
Region Xii Education Service Center 4 $121,200
Aldine Isd 2 $121,144
Education Service Center Region Iii 2 $120,621
Ziegler Cooper Inc 11 $120,048
Vulcan Consulting Llc 2 $120,000
Denise Harrison 1 $120,000
North East Isd 1 $119,907
Dfw Dental Anesthesia Associates Pllc 4 $119,750
Enprotec/Hibbs And Todd Inc 2 $119,712
Zara Environmental Llc 20 $118,367
Tedsi Infrastructure Group Inc 7 $118,134
Weaver And Tidwell Llp 8 $117,121
Workquest-Services 10 $116,864
Texas Energy Engineering Services Inc 8 $116,601
Betty Palmer Architects Inc 7 $116,566
Davis & Santos Pllc 4 $116,146
Destination Analysts 8 $116,080
Southwest Isd 2 $115,977
Kimberlee K Kovach 12 $115,859
The Inspection Group Inc 9 $114,236
Ranger Environmental Services Inc 5 $113,778
Ut Physicians 12 $113,738
Audrey Ann Bowman 9 $113,134
Ut At Permian Basin 5 $112,819
Dhmcelvaney Law Pllc 11 $112,269
Allegis Group Holdings Inc 9 $112,033
Su Clinica Familiar 12 $111,744
Teach Plus Inc Dba Teach Plus 3 $111,109
Beckman Instruments 5 $110,652
Workquest-Products 18 $110,244
Matthew D Browne 10 $110,200
Miller Jones Inc 5 $108,850
David R Harry 15 $108,600
Apsan Technologies Llc 6 $108,560
Esc Region 2 6 $106,800
Denton Isd 2 $106,586
Absolute Facility Solutions Llc 7 $106,585
Threespot Media Llc 5 $106,005
Savvy Technology Solutions Attn Accounting 5 $105,783
Anthony Scott Cunningham 4 $105,575
Texas Department Of Housing And Community Affairs 2 $105,141
Mckim And Creed Inc 3 $104,719
Central Texas Mhmr 8 $104,517
Approach Environmental Llc 2 $104,414
Finquery Llc 1 $104,285
Fourteenth District Court Of Appeals 2 $103,904
Resorce Management Associates Llc 6 $103,680
Baseline Corporation 2 $103,596
Laredo I S D 3 $103,277
Munsch Hardt Kopf & Harr Pc 1 $103,244
Waco Isd 2 $102,926
Perryman Consultants Inc 1 $102,500
Byrdson Services Llc 3 $102,015
I Love You Guys 13 $102,000
Heart Of Texas Community Health Center Inc 6 $101,931
Management Development Inc 1 $101,000
Esc Region 16 3 $100,800
North Texas Area United Way Inc 5 $100,581
Edgewood Independent School District Police 1 $100,279
Coastal Gateway Health Center 1 $100,000
Los Barrios Unidos Community Clinic Inc 1 $100,000
Peoples Community Clinic 1 $100,000
Cross Timbers Health Clinics Inc 1 $100,000
Triangle Area Network Inc 1 $100,000
Brother Bill'S Helping Hand 1 $100,000
East Texas Community Clinic Inc 1 $100,000
East Texas Community Health Services 1 $100,000
Matagorda Episcopal Health Outreach Program Corp 1 $100,000
Jewish Family Service Of Dallas Inc 1 $100,000
Community Health Center Of Lubbock Inc 1 $100,000
Barrio Comprehensive Family Health Care Center Inc 1 $100,000
Mt Enterprise Community Health Clinic 1 $100,000
Martin Luther King Jr Family Clinic Inc 1 $100,000
El Centro De Corazon 1 $100,000
Community Health Centers Of South Central Tx Inc 1 $100,000
El Centro Del Barrio Inc 1 $100,000
St Hope Foundation 1 $100,000
Uh Health 1 $100,000
Community Health Service Agency Inc 1 $100,000
Shackelford Co Community Resource Center 1 $100,000
Gulf Coast Health Center Inc 1 $100,000
Centro De Salud Familiar La Fe Inc 1 $100,000
Coastal Bend Wellness Foundation Inc 1 $100,000
Tejas Health Care 1 $100,000
Centro San Vicente 1 $100,000
Chambers County Public Hospital District Number On 1 $100,000
Populous Inc 3 $99,886
Woodward Aviation Llc 3 $99,038
Pflugerville Isd 2 $98,915
Arrati Incorporated 5 $98,814
Solvenow Inc 18 $97,826
Ayyash Dental Pc 4 $97,400
Lubbock Isd 1 $97,284
Eubank & Young Statistical Consulting Llc 8 $96,870
Dickinson Isd 2 $96,453
Elton David Lee 9 $96,317
Graves Garrett Greim Llc 1 $95,810
Tarrant County Hospital District 13 $95,002
Grand Prairie Independent School District 2 $94,938
United Healthcare Community Plan Of Texas Llc 11 $94,819
Daniel P Wright 7 $94,350
Innovation Event Management Lp 6 $94,258
C3hie 6 $93,500
Rls & Associates Inc 7 $93,395
Bobby E Parker Jr 18 $93,294
La Joya Isd 3 $93,022
Edinburg Cisd 2 $92,228
Lamar Consolidated Isd 2 $91,686
Denton County 1 $91,673
Clear Creek Isd 2 $91,609
Chesney Morales Partners Inc 1 $91,539
Management Concepts Inc 30 $91,509
Eight Eleven Group Llc Dba Brooksource 4 $91,080
Vhs San Antonio Partners Llc 17 $90,958
Dallas County Mhmr Center 5 $90,659
Arlington Isd 2 $90,608
Kimberly C Moore 1 $90,569
Satori Marketing Llc 1 $90,443
Northwest Isd 1 $90,334
Trustpoint Systems Inc 3 $90,000
Region Xviii Education Service Cntr 4 $90,000
Strategic Marketing & Research Insights Llc 6 $90,000
Amtech Solutions Inc 16 $89,999
Fusion Medical Staffing Llc 25 $89,485
Employees Group Insurance Fund 6 $89,400
Resource Data Inc 5 $89,303
The Lawrence Group Architects Of Austin 3 $89,233
Occupational Health Centers Of Southwest P A 22 $88,701
Region Xix Education Service Center 3 $88,200
Statewide Procurements 166 $87,720
Serve & Protect Financial Texas Llc 1 $87,500
Mission Critical Partners Llc 4 $87,482
Williamson County And Cities Health District 1 $87,106
Esc Region 17 6 $87,000
The Segal Company (Southeast) Inc 2 $86,874
Fusion Tekpro Inc 5 $86,636
Dynamic Computing Services Corporation 8 $86,613
Temple Isd 2 $86,519
Hutson Land Planners & Development Consultants Llc 16 $86,405
Frisco Isd 7 $86,360
Hurst-Euless-Bedford Isd 2 $85,886
Ecosystem Planning And Restoration Llc 6 $85,870
Condray Design Group Inc 9 $85,777
Simplifyd Consulting Group Llc 4 $85,752
Womens And Mens Health Svcs Of The Coastal Bend In 6 $85,017
Masterson Advisors Llc 1 $85,000
O'Connell Robertson And Associates Inc 5 $84,611
Astra Connect Llc 6 $84,555
Dynamic Technology Solutions 7 $84,306
Shackelford Mckinley And Norton Llp 6 $83,931
Ht Staffing Solutions Llc 5 $83,520
Wichita Falls Isd 2 $83,022
Whitestone Healthcare Llc 27 $82,986
East Central Isd 2 $82,878
Cross Engineering Consultants Inc 9 $82,795
Global Environmental Consulting Inc 8 $82,395
Accurate Order Solutions Llc 6 $82,260
Alliance Work Partners 54 $81,894
Brazosport Independent School District 1 $81,389
Alamo Community College District 1 $81,250
Apollo Information Systems Corp 3 $81,000
Lauterbach & Amen Llp 10 $80,623
Smith System Driver Improvement Institute Inc 9 $80,574
Elsym Consulting Inc 5 $80,000
Kovexa Solutions Llc 4 $80,000
Texas Medical Legal Consultants Llc 11 $79,855
Prime Time Healthcare Llc 14 $79,101
Alan Pursley 2 $79,000
Nueces County 1 $78,750
Midtown Personnel Inc Dba The Midtown Group 6 $78,709
John Mahoney 5 $78,165
Collin County Mhmr Center 7 $78,016
Mansfield Isd 2 $77,805
Raines Consulting & Public Affairs Inc 18 $77,787
Bryan Isd 2 $77,701
Transpro Consulting Llc 6 $77,598
Zachary Kennedy Md 5 $77,520
Texas Tech Univ Health Sciences Center At El Paso 35 $77,159
Settje Agri Services And Engineer 2 $76,538
South East Texas Regional Planning Commission 1 $76,032
Donna Isd 2 $75,974
Haddon + Cowan Architects 12 $75,804
Lumen Solutions Group Inc 5 $75,240
The Meadows Mental Health Policy Institute For Tx 1 $75,000
Lower Rio Grande Valley Development Council 22 $74,930
Intersectional Psychotherapy Pllc 18 $74,821
Galena Park Isd 2 $74,435
Mauro Psychological Service Pllc 14 $74,401
Wylie Isd 2 $74,326
Roc Search Inc 13 $73,943
Blanchard Group Unlimited Llc 4 $73,850
Hollaway Environmental And Communications Services 12 $73,740
Keystone Aerial Surveys Inc 11 $73,706
Mcallen Isd 2 $73,345
White Oak School 6 $72,800
Star Nursing Inc 33 $72,762
Happy Soul Counseling And Wellness Pllc 6 $72,517
United Way/West Central Texas 1 $72,026
Environmental Systems Research Inst Inc 2 $71,627
Mmc Group Lp 5 $71,512
William Cameron Boone Iv 8 $71,500
Maxim Healthcare Services Holdings Inc 17 $71,383
Jonathan Archer 7 $71,250
Region Viii Education Service Center 6 $70,800
Lengo Strategic Partners Llc 4 $70,282
The Levy Company Llc 1 $70,137
The United Ways Of Texas Inc 6 $70,002
Boston Partners 2 $69,977
Hays Cisd 2 $69,926
South Texas Family Planning & Health Corporation 6 $69,898
Middle Rio Grande Dev Council 26 $69,822
Rbdr Pllc 4 $69,793
Acs Primary Care Physicians-Southwest Pa 7 $69,688
Edgar Paul Hornsby 2 $69,550
Autumn Beth Sorensen 12 $69,075
Vintage It Services 23 $68,525
Crowley Isd 1 $68,418
Region V Education Service Center 4 $68,400
Esc Region 15 6 $68,400
Tx International Institute Of Health Professions 6 $67,758
Dk Partners Pc 1 $67,508
National Society To Prevent Blindness 6 $67,320
Eagle Mountain Saginaw Isd 1 $67,169
Mnk Architects Inc 5 $66,663
University Of Texas Liberal Arts Career Services 4 $66,628
Newgen Strategies And Solutions Llc 3 $65,846
Sans Institute 1 $65,832
Elliot Griffin 5 $65,000
Sr3 Llc 2 $64,950
Barker & Herbert Analytical Laboratories Inc 17 $64,800
Saiandsai Solutions Llc 4 $64,480
Cohen Milstein Sellers & Toll Pllc 6 $64,112
City Of Austin-Management Services 3 $62,991
Raftelis Financial Consultants Inc 1 $62,635
Presley Design Studio Lc 24 $62,553
Business Intelligence Advisors Inc 1 $62,500
Tyler Isd 1 $61,581
University Of Texas Health Science Center At San A 30 $61,154
Cem Benchmarking Inc 1 $61,000
Jae Law Group 4 $60,288
Erc Environmental & Construction Services Inc 2 $60,107
Visionlink Inc 6 $60,090
Balcones Geotechnical Llc 2 $60,000
Yunping Hu 6 $60,000
Tamus Health Science Center 1 $60,000
Escamilla & Poneck 1 $60,000
Peerplace Networks Llc 1 $60,000
Julie R Ortiz Cpa 6 $60,000
The Institute For Applied Network Security Llc 2 $59,829
Culligan Ultrapure Inc 9 $59,701
Mark C Schulze 2 $59,700
Texas Commission On Environmental Quality 3 $59,322
Sunset Anesthesia Services Pllc 9 $58,931
Darla Cloud 41 $58,860
Smart Information Mgmt Systems Dba Smart Ims Inc 18 $58,801
Sbl Architecture Inc 7 $58,777
Colette Holt & Associates 2 $58,600
Del Valle Isd 2 $58,573
Dean Runyan Associates Inc 6 $58,368
Melissa Ehrhardt 20 $58,000
Sandra Lowe Attorney At Law 5 $57,939
Lynn E Rubinett 7 $57,870
Tuyet Elan 10 $57,720
Hmg & Associates Inc 8 $57,638
Midland Isd 2 $57,347
Cima Solutions Group Llc 7 $57,278
West Central Texas Council Of Governments 25 $57,054
Michael Colacchio 3 $56,554
Vitaver And Associates Inc 9 $56,483
Ut Health Science Center San Antonio 31 $56,080
Herman Lee Llc 14 $55,893
Frank Low Voltage Llc 17 $55,878
Fanning Fanning & Associates Inc 4 $55,859
Chupik Behavioral Health Pllc 4 $55,632
Ector County Isd 1 $55,553
Marina Roy Buenaventura 6 $55,500
Lynn Criner Dvm Pllc 14 $55,438
W3it Design Llc 6 $55,404
Alliance Laboratories Inc 12 $55,381
Jennings Enterprises Consulting Llc 13 $55,380
Rj Rivera Associates Inc 1 $55,108
Mclane Technology Partners Lp 5 $54,503
Belton Isd 2 $54,362
The Hartnett Law Firm 1 $54,347
Kst Data Inc 5 $54,064
Lauren K Canady 6 $53,814
Jason Dale Dunham 9 $53,703
Comal Isd 2 $53,638
Dibrell Page Dobbs 6 $53,180
Jefferies Finance Llc 1 $52,968
Federal Funding Training And Consulting Llc 1 $52,800
David Brent Pitts 8 $52,750
Signature Staff Resources Llc 21 $52,705
Safe And Sound: A Sandy Hook Initiative 4 $52,625
Promet Solutions Corporation 5 $52,525
Nurse-Family Partnership 2 $52,500
Leonard Rice Consulting Water Engineers Llc 4 $52,479
City Of Laredo 10 $51,853
Rock Solid Trail Contracting Llc 1 $51,800
Eagle Pass Isd 4 $51,415
Texas A & M University Commerce 2 $51,370
Nance & Carmichael Pc 6 $51,019
Esc Region 9 5 $51,000
Texas Regional Medical Center Llc 2 $50,942
Acr Engineering Inc 4 $50,774
Jason Jackson 3 $50,500
Texas Agrilife Research 4 $50,071
Aqua Strategies Inc 1 $50,000
Jpg-Ejg Llc 5 $50,000
T D Bank N A 1 $50,000
Horia Moroaica 11 $49,998
Collins Family Planning Clinic 4 $49,980
Texas A&M System Shared Services Center 6 $49,908
The Center For Employment Security Education 2 $49,813
Meta Associates 3 $49,700
Vernice Seriale Jr 5 $49,500
Crowdplat Inc 8 $49,305
Uptodate Inc 2 $49,284
New Caney Independent School Dist 2 $49,250
Lance Miller Phd Llc 4 $49,187
Tahoe Medical Ventures Llc 6 $49,140
International Projects Consultancy Services Inc(Ic 3 $49,116
Carson Block Consulting 6 $48,810
Alan Boyd Consultants Inc 2 $48,801
Tomball Isd 2 $48,700
White Settlement Isd 2 $48,547
Rio Grande Council Of Governments 19 $48,462
Crews Group Partners Llc 8 $48,358
Midtown Personnel Inc 2 $47,880
Darrel B Turner 5 $47,875
Direct Care Rehab Pllc 6 $47,676
American Medical Staffing Inc 18 $47,497
Law Office Of Elizabeth Chappell Pllc 6 $47,240
Beaumont Isd 2 $47,144
National Association Of State Mental Health Progra 3 $47,126
Alchemy Technology Group Llc 7 $47,093
Instantserve Llc 3 $46,830
East Texas Council Of Governments 18 $46,704
Los Fresnos Cisd 2 $46,648
Jason M Mushinski 4 $46,300
The Admiral Nimitz Foundation 2 $46,239
Wicklander-Zulawski & Associates Inc 2 $46,202
Panhandle Reg Planning Comm 25 $45,862
Mwm Design Group Inc 5 $45,789
Zinfinity Llc 3 $45,635
Brownsville Psychological Center Pllc 6 $45,498
Weslaco Isd 1 $45,378
Matthew C Whitney 5 $45,250
Ctrace Solutions Inc 10 $45,241
Mhmr Of Tarrant County 5 $45,094
Mighty Citizen Pbc 7 $44,806
Maria Isabel Antu 14 $44,791
Harlingen Cisd 1 $44,662
University Emergency Medical Response 1 $44,550
Brazos County 2 $44,547
Advanced Imaging Services Inc 2 $44,500
Uiversity Of Texas Medical Branch At Galveston 1 $44,307
Story Reason Llc 7 $43,997
Fischer International Identity Llc 2 $43,659
Fms Mediation Llc Dba Fms Dispute Resolution Servs 5 $43,341
Ml Bryant Interests Llc 5 $43,333
Bridgesight Inc 5 $43,310
New Horizon Strategies Llc 4 $43,115
Monday Rufus & Co Pc 3 $42,686
Qualtrax Inc 2 $42,593
Andco Consulting Llc 2 $42,500
Garza/Gonzalez & Associates 4 $42,310
Superior Healthplan Inc 5 $42,288
South San Antonio Isd 1 $42,280
San Jacinto College District 14 $42,276
Desby Technologies Inc 7 $42,224
Golden Key Group Llc 5 $42,020
Wiley B Mcafee Jr 1 $42,000
Acacia Heritage Consulting Llc 6 $41,878
City Of Fort Worth 3 $41,681
Philip R Taft Psy D And Associates Pllc 13 $41,402
Everman Isd 2 $41,393
Electrical Training Service 8 $41,383
Workers Assistance Program 11 $41,308
Dugger Grafe Swanson Inc 4 $41,250
Weatherford Isd 2 $41,242
Ark Tex Council Of Governments 19 $41,013
Careflite 6 $40,942
Duncanville Isd 2 $40,818
Taygor Associates Llc Lc Gordon Jr 5 $40,800
It Enabled Llc 5 $40,535
Lightspeed Locating Llc 4 $40,453
Catalis Courts And Land Records Llc 1 $40,386
Focus Consulting Group Inc 5 $40,133
Rockwall Isd 2 $40,035
Epiphany Associates 1 $40,000
Fabian Avina 4 $40,000
Standard And Poors Financial Services Llc 1 $40,000
Keith C Brown 2 $40,000
Yellowbook Cpe Llc 2 $40,000
Garrett State Tax Service Inc 4 $40,000
Jacob And Martin Llc 3 $40,000
Texas Casa Inc 2 $39,853
Central Texas Council Of Governments 20 $39,786
Victor M Pena 5 $39,650
Dr Kirklin R Smith Md 7 $39,618
Paul Hernandez 5 $39,600
Daniel Osborn 10 $39,600
Port Arthur Isd 3 $39,529
Sims & Associates West Inc 5 $39,528
Enterprise Training Solutions 1 $39,512
Prestigious Agency Llc 16 $39,496
Robert Esterquest 9 $39,455
Micropact Global Inc 2 $39,388
Siter Neubauer And Associates Inc 12 $39,313
In Depth Events Inc 1 $39,213
Reflection Executive Advisors Llc 11 $39,000
Schluter Land Solutions Llc 1 $39,000
Coastal Bend Council Of Government 24 $38,945
Channelview Isd 1 $38,642
West Oso Independent School District 1 $38,613
Charles P Woodrick Phd 7 $38,600
Fibertown Dc Llc 12 $38,593
Permian Basin Regional Planning Commission 23 $38,526
The Ishee Group Llc 4 $38,307
Energy Testing And Balance Incorporated 3 $38,260
Sacred Cross Ems Inc 2 $38,230
Teresa Cruz-Beck Otr Pllc 18 $38,205
Callie Howard Braddock 2 $38,000
Aca Performance Services 2 $38,000
Sanchez-Salazar & Associates Llc 3 $37,975
Digital Air Control Inc 1 $37,909
Dhhs/Acf/Office Of Child Support Enforcement 1 $37,891
Hatwell Group Llc 3 $37,867
Crosby Isd 2 $37,760
Diane Fulmer 22 $37,700
Central Counties Ctr 3 $37,510
Richard Kolodner 2 $37,500
Marsbear Tech 1 $37,486
Andres J Gonzalez 4 $37,420
Ex Libris (Usa) Inc 2 $37,025
City Of Wichita Falls 1 $36,989
Ricardo Salazar 4 $36,880
King Consultants Inc 2 $36,800
U S Government Accountability Office 1 $36,690
Brazos Valley Council Of Governments 20 $36,500
Occupational Health Centers Of The Southwest Pa 24 $36,439
City Of Amarillo 1 $36,343
Mgt Of America Consulting Llc 2 $36,295
Bain Medina Bain Inc 1 $36,262
Manor Isd 2 $36,233
The Chris Bourgeacq Law Firm Pc 5 $36,207
Stephen W Wyatt 2 $36,000
Key Operational Insights Llc 7 $36,000
Edcouch Elsa Isd 2 $35,672
Leanne Lowish Consulting 7 $35,500
I3-Imagesoft Llc 2 $35,490
Victoria Independent School District 1 $35,054
State And Local Tax Group Llc 4 $35,050
Yuanyuan Zhou 6 $34,950
Deepsedation P C 5 $34,800
San Felipe Del Rio Cisd 2 $34,733
Bravo Consulting Group Llc 1 $34,456
Bell County Public Health District 2 $34,357
Occupational Health Centers Of The Sw Pa 74 $34,342
Nicholas Edd 8 $34,243
Anna Isd 1 $34,192
Fondation Pour La Formation Continue Universitaire 3 $34,091
Vintage Computer Brokers Inc 6 $34,011
Shackelford Bowen Mckinley And Norton L 2 $33,576
The Escal Institute Of Advanced Technologies Inc 3 $33,500
Daniel E Williams 4 $33,490
Raba-Kistner Consultants Inc 10 $33,451
Southside Independent School Dist 2 $33,296
Seguin Isd 2 $33,201
Epignosis Llc 1 $33,060
F Guerra Deberry Llc 6 $32,974
South Texas Development Council 21 $32,910
San Benito Cisd 1 $32,865
Lake Worth Independent School District 2 $32,565
Keller Independent School District 2 $32,500
David Shoemaker 2 $32,400
Parnell Ryan 15 $32,400
Khoa Tran Pllc 13 $32,224
Galveston Isd 2 $32,173
Timelymd 1 $32,126
Edgate Correlation Services Llc 2 $32,067
Kowert Hood Munyon Rankin & Goetzel Pc 20 $31,963
Superior Water Management Of Texas Llc 5 $31,760
Ruthanne Garcia 7 $31,744
Texas Veterinary Medical Diagnostic Laborator 7 $31,734
Vitaver & Associates Inc 2 $31,416
Resolution Forensic And Consultation Services Pllc 15 $31,400
Lockhart Isd 2 $31,266
Nortex Regional Planning Commission 20 $31,258
Spoken Word Communications 4 $31,200
Cbm Archives Co Llc 4 $31,154
The Bruman Group Pllc 44 $31,034
American Management Association International 8 $31,007
Jacqui Dodson Aia Architecture & Interior Design 11 $31,007
Sherman Isd 2 $30,940
Alvin Isd 2 $30,904
John H Reed Jr Dds Pllc 3 $30,803
Collin Cnty Mental Health Mental Retardation Ctr I 6 $30,670
South Plains Public Health District 6 $30,664
Angelina County & Cities Health District 2 $30,662
Lja Program Management Llc 1 $30,636
Holly Robles 5 $30,527
Joseph B Lawhon 9 $30,500
Dwondlyn S Chatman 3 $30,400
Jamilya Rangel 11 $30,395
Carter Design Associates Inc 1 $30,335
Christopher Mark Cornwell 2 $30,125
Api National Service Group Inc 1 $30,115
Dylan R Leblanc 9 $30,030
Delisi Communications Inc 12 $30,000
Gina Cannova Phalen 1 $30,000
M&F Partnership Llc 3 $30,000
Bierschwale Land Company Llc 1 $30,000
Achram Labs Llc 1 $30,000
Iqnoor Bains 1 $30,000
Career Education Inc 5 $29,975
John E Geltosky 2 $29,913
Atcic 1 $29,786
Collin County Mhmr Center Dba Lifepath Systems 1 $29,783
Harchik Associates Llc 6 $29,761
Ronald D Robinson 3 $29,700
Julio A Ochoa 10 $29,536
Rl Townsend And Associates Llc 5 $29,416
Univ Of Texas Southwestern Medical Ctr 7 $29,359
Mario A Caro 4 $29,150
Nicole J Schechter 2 $29,000
Executive Information Systems Llc 10 $28,941
Athena Actuarial Consulting Llc 1 $28,800
United Engineers Inc 1 $28,785
Kfw Architects 3 $28,740
Central Psychological Services Pllc 16 $28,600
Donald T Matthews 8 $28,500
Lamar University Operating Direct Deposit 1 $28,488
Incontact Inc Dba 4 $28,256
The Edd Clinic For Psychotherapy & Counseling Pc 10 $28,166
Splendora Isd 2 $28,120
Ut Health Science Center Of San Antonio 7 $28,110
Sandman Anesthesia Services 6 $28,090
Jacob & Martin Llc 5 $28,087
Eecs Llc 2 $28,083
Creative Training Techniques Inc 7 $28,030
Tarrant County College District 2 $28,000
Nueces County Sheriffs Office 2 $28,000
Contract Service Innovations Llc 3 $27,982
Haven Psychology Llc 8 $27,825
Business & Financial Management Solutions Llc 4 $27,551
Raymondville Independent School District 2 $27,509
Goldcal 4 $27,500
Jonathan Seward 2 $27,500
La Porte Isd 2 $27,401
Joshua Isd 2 $27,203
Cleveland Isd 2 $27,097
University Of Texas Sw Medical Center 2 $27,059
Embraer Cae Training Services Llc 1 $27,011
Lubbock Cooper Isd 2 $26,770
Kimberly Abbey Parks 1 $26,699
Montrose Air Quality Services Llc 4 $26,620
Sigma Survelliance Inc 2 $26,600
The University Of Texas At Austi 1 $26,518
Northeast Texas Public Health District 2 $26,490
The Harris Law Office Pllc 1 $26,400
Enterprise Performance Strategies Inc 1 $26,400
Lori B Wasserburger 6 $26,364
Life Anew Restorative Justice 16 $26,348
Risk Strategies Consulting Inc 6 $26,280
Revolution Amc 4 $26,000
Granbury Isd 2 $25,979
Lue Dillard 5 $25,884
Trace First Inc 2 $25,791
Sujan Gogu Sgdo Pllc 3 $25,749
David E Rothschild Md 3 $25,749
Alice Cox Md 3 $25,749
Spectrum Imaging Technologies Inc 1 $25,746
Txc Texas Creative Ltd 12 $25,713
Forensic Behavior Management Institute 6 $25,685
Checkmate Surveillance Investigators Llc 11 $25,600
Synegen Inc 2 $25,576
Indus Mokshum Llc 6 $25,500
Connally Isd 2 $25,481
Texas Public Health Association 2 $25,425
Pleasanton Isd 2 $25,347
Monkee-Boy Web Design Inc 6 $25,308
Abr Advisory Consultants Llc 6 $25,258
Intrnl Center For Mgmt&Organization Effectiveness 4 $25,227
Flor Hermida Holmes 3 $25,110
Maria Elena Martinez 2 $25,000
Jason S Lewis 2 $25,000
Peter Jones 2 $25,000
Honeycomb Management Group Llc 4 $25,000
Eric R Fearon 2 $25,000
Carol Prives 2 $25,000
Kristan Reimann 1 $25,000
Texas Association Of City & County Health Official 1 $25,000
Bowyer Research 1 $25,000
Touchnet Information Systems 1 $25,000
Margaret Tempero 2 $25,000
Richard O'Reilly 2 $25,000
Chavi Llc 2 $25,000
Karen Case And Associates 11 $24,990
Upchurch Architects Inc 2 $24,962
Designs That Compute 2 $24,949
Steven M Croft Mdpa 14 $24,900
Catherine J Loonam 8 $24,750
Tba San Antonio Llc Dba Tba Douglas 4 $24,750
Databank Imx Llc 3 $24,722
City Of South Padre Island 2 $24,688
Echospan Inc 1 $24,650
Maybelle Sim 6 $24,642
Double Barrel Title Llc 1 $24,625
Kerrville Independent School District 3 $24,478
Jacob A Atuahene-Nsowaah Llc 5 $24,438
Robert J Gilpin 2 $24,385
Leon Alcala Morse & Reynolds Pllc 13 $24,337
Civil Design Services Inc 1 $24,336
Shi Government Solutions 3 $24,254
Canyon Isd 2 $24,153
Doc2e-File Inc 4 $24,141
Truce Dispute Resolution Firm 7 $23,995
B & R Engineering Inc 2 $23,952
County Clerk Of Cherokee County 6 $23,910
Adorn Technologies Llc 2 $23,826
Toptalent Learning Llc Dba New Horizons Dallas 6 $23,823
Access Esperanza Clinics Inc 6 $23,604
Canutillo Isd 1 $23,589
Haven Health Clinics 6 $23,562
In The Image Llc 6 $23,500
Peoples Success Consulting And Development Llc 1 $23,500
Maximus Us Services Inc 2 $23,500
Online Consulting Inc 6 $23,460
El Paso County 5 $23,194
Pearland Isd 2 $22,962
Uthc Tyler 18 $22,801
Lewisville I S D 7 $22,795
Ste Transcore Holding Inc 1 $22,748
Christina Ho 2 $22,700
The Arkitex Studio Inc 4 $22,653
Thanh Taylor 2 $22,514
Stephen A Thorne Phd Pllc 13 $22,400
Leon G Freeman 4 $22,375
Wayfinding Consultants Llc 4 $22,330
Kemp Isd 1 $22,322
Garcia Hamilton & Associates L P 2 $22,230
Governor'S Center For Management Development 6 $22,200
Morgan Stanley Capital Management Llc 2 $22,183
Richmond Capital Management 2 $22,162
Bradley A Areheart 5 $22,095
David Degroot 3 $21,934
Master Jewelry Appraisers Llc 1 $21,840
Willis Isd 1 $21,837
Crosdale & Associates Llc 2 $21,744
Mark Stephenson Dds Pc 6 $21,716
A Best International Placement Services Llc 9 $21,588
Process & Safety Solutions Llc 3 $21,447
Melanie Ray 1 $21,375
Rock Medical Group Llc 4 $21,364
Brown Consulting Engineers Inc 1 $21,350
New Braunfels Independent School District 1 $21,252
Jkb Medical Exams Llc 25 $21,193
Patricia Teeler 5 $21,175
Ag3 Group Llc 1 $21,107
Deer Park Ind School Dist 1 $21,089
Alvarado Isd 2 $21,039
Twi Consultants Llc 1 $21,000
Lubbock Regional Mh & Mr 1 $21,000
Texarkana Isd 2 $20,988
Infection Prevention & Management Associates Inc 1 $20,800
Hicks & Company Environmental 4 $20,778
Keerthi Vemulapalli 10 $20,735
Railroad Infrastructure & Terminal Development Llc 1 $20,678
Midlothian Isd 2 $20,609
Kristine Swiderek 3 $20,550
Kokel Oberrender Wood Appraisal Ltd 2 $20,500
National Cancer Registrars Association Inc 3 $20,462
The Center For Social Capital Inc 4 $20,405
Metro Aviation Inc 1 $20,329
Stratactic Llc 2 $20,263
Hutto Isd 2 $20,232
Yellowbook-Cpe Llc 25 $20,216
Robert L Moorman 1 $20,100
Hurt Jacknow Moore Conner Wells Michels Yurc 2 $20,000
Cape Endeavors Inc 5 $20,000
State Sales Tax Consulting Llc 2 $20,000
Brenda Tschirhart 2 $20,000
Kintsugi Ventures Llc 2 $20,000
Lisa Marie De La Luz 2 $20,000
Council On Licensure Enforcement And Regulation 7 $19,985
Health And Human Services Commision 5 $19,970
National Judicial College 2 $19,947
University Of Texas Of Austin 13 $19,900
West Texas A And M University 1 $19,877
Rfabyan Consulting Llc 2 $19,800
Wayne A Powe 2 $19,800
Rebecca Shannon 21 $19,675
Korey L Watkins 12 $19,475
Community Advocacy Research & Evaluation Consultin 3 $19,436
Concho Valley Center For Human Advancement 4 $19,276
Colin Turnbull Consulting Llc 3 $19,250
City Of Kerrville 9 $19,229
Cms Clinic 11 $19,170
Athens Hospital Llc 1 $19,170
Enterprise Training Solutions Inc 1 $19,110
Sterling Computers Corp 1 $19,102
Driver Training Solutions Llc 1 $19,100
Bradley Bujan 2 $19,050
First Steps Prosthetics & Orthotics Pllc 1 $19,047
Slg The Millennium Group Llc 2 $19,040
Steven D Weinstein 2 $18,800
Angela Downes Pllc 7 $18,765
Jason C Reece 1 $18,750
Kara Gianni 1 $18,750
Phoenix Composition Inc 1 $18,750
Higher Digital Inc 4 $18,731
Jamie Eller 1 $18,719
Marisela Maddox Dba Stories To Solutions Pllc 6 $18,686
Tgw Superiorcare Mts Llc 11 $18,656
Crandall Isd 2 $18,647
Water Finance Exchange Inc 2 $18,512
Ross Brownson 2 $18,500
Nancy Lee 2 $18,500
Jeff Tillman 6 $18,500
Tuloso-Midway Isd 2 $18,461
Skillpath Seminars 25 $18,394
Recruiting Source International Llc 1 $18,392
Stephan A Thorne Phd Pllc 10 $18,314
Helium Medical Services Pllc 7 $18,300
Texas Attorney General 7 $18,250
Law Office Of Andrew Froelich 10 $18,140
The Mccombs School Of Business Foundation 1 $18,000
Jeremy Glosser 10 $18,000
Mg Family Medicine Pllc 6 $18,000
Eurofins Environment Testing South Central Llc 4 $17,855
Debra Anne Cotton Dba The Cotton Law Firm Pllc 6 $17,801
University Of Texas Md Anderson Cancer Center 2 $17,736
Jaime Beaman Aia Inc 5 $17,704
Zapata County Isd 2 $17,664
Terrell Aviation Inc 3 $17,639
Broadleaf It Llc 2 $17,635
Realford Consulting Llc 2 $17,601
Altura Solutions Llc 6 $17,600
Aniece Hope Rogers 6 $17,596
Nichevision Forensics Llc 1 $17,550
Cynthia D Rivera Md Pllc 7 $17,500
Plano Isd 3 $17,500
Gregory Paul Md Pa 1 $17,400
Texas A& M University Kingsville 2 $17,304
South Texas Aviation Academy Llc 3 $17,221
Neely Behavioral Health Dba Neely Eap 16 $17,208
Renzo Canetta 2 $17,175
Emergenchealth Llc 7 $17,095
E&F Audio Visual Rental & Sales Llc 1 $17,073
Ector County Hospital District 6 $17,029
Prologic Consulting Inc 2 $16,940
Abbeville Special Needs Dentistry Pllc 7 $16,896
Kelly Hart & Hallman Llp 3 $16,893
The Francis Firm Pc 28 $16,849
Choosing The Best Publishing Llc 1 $16,675
Sulphur Springs Isd 1 $16,667
The Browning Group International Inc 2 $16,660
Texas Funeral Directors Association 4 $16,656
Cypress Environmental Consulting Llc 6 $16,623
Huntsville Isd 2 $16,600
Encotech Engineering Consultants Inc 1 $16,593
Lory R Johnson 2 $16,500
Jarden Legal Services 6 $16,470
Earnest W Scott 6 $16,431
Tab Technologies Llc 4 $16,387
R Bryan Gulley Dds Pllc 5 $16,355
Best Best & Krieger Llp 4 $16,344
Jennifer Vann 4 $16,300
Responsiveed Texas 4 $16,250
Miguel Oneto Md Pa 5 $16,211
Robert Alley 3 $16,059
Wichita Falls Cardiac Care Pa 15 $16,046
Hilltop Holdings Inc 3 $15,985
Prentgraf Ltd 6 $15,980
Mathis Isd 1 $15,774
Clinical Pathology Laboratories Inc 18 $15,749
Roy Cosan 2 $15,713
Blackwell Ventures Inc 5 $15,699
Angleton Isd 1 $15,646
Life Ambulance Serivce Inc 11 $15,529
Santa Fe Independent School District 2 $15,500
Evolving Texas Lp 5 $15,500
Homer P Campbell Dba Phil Campbell 23 $15,491
Laurie L Dotter 3 $15,479
Toxstrategies Llc 4 $15,312
Robertson Anschutz Vetters 3 $15,300
Lumberton Isd 2 $15,295
Greenville Isd 2 $15,274
Rehmani Consulting Inc 1 $15,252
Texas Healthcare And Bioscience Institut 1 $15,000
Erica R Ries 1 $15,000
Ashley Soape 1 $15,000
Deep Earth Technologies Inc 1 $15,000
Etmc Ems 6 $14,991
Kelly Bolton 2 $14,900
Jourdanton Isd 2 $14,899
Kirklin R Smith 2 $14,885
Jerry Ware 19 $14,850
Estela Sosa Md 6 $14,850
Eric Cash 5 $14,800
Paramount Wastewater Solutions Llc 3 $14,759
Tyler Hickle 8 $14,654
Troy L Coleman Ph D Inc 7 $14,626
Vidor Isd 2 $14,595
Connected Nation Inc 1 $14,518
Kevin Zane Demirci 8 $14,501
Stafford Msd 2 $14,473
William G Yeats 8 $14,400
Thanh An Nguyen 6 $14,400
Sedadent Anesthesia Services Pllc 3 $14,375
Sherry Marsh 6 $14,346
Barcacel Eye & Vision Pllc 3 $14,300
Jared Ruchensky 5 $14,300
Peterson Medical Associates 18 $14,203
Covelo Direct Llc 5 $14,196
Claude R Clinton Iii 1 $14,160
Palestine Isd 1 $14,147
Hillsboro Isd 2 $14,140
Burkburnett Isd 2 $14,105
Ginette Serrero 2 $14,088
Kerrville Oms Pllc 3 $14,075
Texas Awwa 2 $14,000
Victoria County 1 $13,961
Cayuse Llc 2 $13,906
Emsystem Llc 7 $13,825
Montgomery A Verona 6 $13,800
Region 14 Education Service Center 1 $13,800
Amz Appraisal Llc Dba 7 $13,800
Laura Metcalf 6 $13,758
Waxahachie Isd 3 $13,750
Cynet Health Inc 2 $13,748
Rehabilitation Hospital Llc 4 $13,637
Care Inns Of Texas - Temple Ltd 2 $13,518
State Bar Of Texas 23 $13,485
Onterris Air Quality Services Llc 2 $13,310
Ryan Mccollum 11 $13,300
James S Hanes 6 $13,300
210 Driving Academy Llc 2 $13,200
John E Reid And Associates Inc 1 $13,125
Society Of Trauma Nurses Inc 1 $13,100
Gahagan And Bryany Associates Inc 5 $13,072
Gonzalez Dentistry Inc 7 $13,020
Auspicious Laboratory Inc 6 $13,000
John Males 3 $13,000
Renee M Rusch 5 $12,965
Valley View Isd 2 $12,939
Intentional Communication Inc 1 $12,816
Sheila Mundy 4 $12,775
Mabank Isd 2 $12,774
Grapevine-Colleyville Isd 2 $12,643
Soto & Soto Dental Partners Pllc 10 $12,620
Cuero Isd 2 $12,616
Psychological Assessment & Services Pllc 3 $12,600
Hidalgo Isd 2 $12,577
Bruce Blazar Llc 2 $12,500
Education Strategy Group Llc 1 $12,500
Nathanael Schiander Gray 2 $12,500
Parking Logix Corporation 1 $12,497
Genesis Anesthesia Pllc 3 $12,400
Uvalde Cisd 2 $12,353
Austin Oral & Maxillofacial Surgery Associates Pa 3 $12,306
Carlos Javier Ramirez 20 $12,265
Pine Tree Isd 2 $12,254
Ecj Services Llc 2 $12,245
Grayson County 2 $12,174
Grace Hebert Curtis Architects Llc 1 $12,170
Milligan Partners Llc 6 $12,166
Kristen Walden 3 $12,155
Jill Mccarthy Arntz 5 $12,150
Warren Creative Consulting Llc 5 $12,126
Columbia-Brazoria I S D 2 $12,095
Michael Best & Friedrich Llp 16 $12,090
Gene G Reister 10 $12,000
Preston Chastine 1 $12,000
Tempest Interactive Media Llc 6 $12,000
Martinez Rosario & Company Llp 3 $11,965
Marsha K Ridlehuber 7 $11,946
Huffman Isd 2 $11,938
Usacs Integrated Acute Care Services Of Texas Pllc 23 $11,924
Gonzales Independent School District 1 $11,865
Administrative Justice Institute Llc 2 $11,850
Immixtechnology Inc 1 $11,840
Alice Thompson 3 $11,830
Texas Suicide Prevention Collaborative 2 $11,741
Point Isabel Isd Police Dept 2 $11,733
Symphone Diagnostic Services No 1 Llc 2 $11,716
Southeastern Assoc Of Fish And Wildlife Agencies 1 $11,708
Nederland Isd 2 $11,707
Sinton Isd 2 $11,682
The San Jacinto Museum And Battlefield Association 1 $11,664
Tx Law 5 $11,600
Langston Scott Adams 22 $11,545
Quentin Woods 1 $11,538
Donna Almeida Counseling Pllc 6 $11,500
Shannon L Smith Mdpa 8 $11,464
Shiloh Family Dentistry Pllc 5 $11,428
T Baker Smith Llc 2 $11,392
Donald S Frazier 8 $11,383
Silsbee Isd 2 $11,353
Ninjio Inc 1 $11,290
Special Education Assessment Specialists Llc 6 $11,250
Acclivity Performance 1 $11,250
William K Goode 6 $11,240
Leadership Studies Inc 3 $11,219
Boerne Isd 2 $11,217
Adminmonitor Inc 2 $11,200
Gunther A Goetz 6 $11,194
Certification Board Of Infection Control & Epidemi 1 $11,180
Consolidated Traffic Controls Inc 3 $11,180
Barbara L Stroud Pllc 6 $11,161
Medical Doctor Associates Llc 2 $11,160
Rudd And Wisdom Inc 1 $11,100
Community Medicine Associates 16 $11,050
Robert D Goldstein Cpa 5 $11,038
Bo E Saxberg 2 $11,000
Elaine V Jones 2 $11,000
Amelie Karam Tidwell 2 $11,000
Pirkey Barber Pllc 9 $10,972
Colvin Saenz Rodriguez & Kennamer Lpp 2 $10,958
Stephanie Noelani Martinez 6 $10,950
Lawrence N Nwora 18 $10,910
Insight Psychology And Behavorial Health Services 2 $10,898
Omonzusi M Imoboih 3 $10,880
Rajesh M Mehta Md Inc 1 $10,774
Mcelroy Sullivan Miller & Weber Llp 5 $10,748
Mexia Principal Healthcare Limited Partnership 1 $10,675
Thornton Medical Pllc 25 $10,650
Waters Vollmering Beavers & Adams Llp 7 $10,597
Fiona Boyd 14 $10,590
Columbus Independent School District 2 $10,578
Lufkin Isd 2 $10,568
Christi B Glendinning 3 $10,550
Nicholas Ravanelli 2 $10,525
John C Bernal Dvm Cores Veterinary Consulting 4 $10,500
Margaret Christen 6 $10,500
Qualex Corporation Dba Doctract 1 $10,491
Stites Tax Consulting Group Gp Llc 1 $10,400
Dilley Isd 2 $10,376
Ets-Tx 3 $10,372
Great South Texas Corporation 7 $10,335
Andrea L Hutchison 7 $10,326
Jasper Newton County Public Health District 6 $10,232
Kristy L Durkovic 19 $10,215
Daniel Jack 17 $10,140
Psychwire Australia Pty Ltd 1 $10,067
Price Consulting Inc 2 $10,048
Progreso Isd 2 $10,023
Shala Massey 1 $10,000
Examination Services Llc 2 $10,000
Dbsync Inc 1 $10,000
Dennis Kivlighan Iii 1 $10,000
Leah Danielle Zavala 4 $10,000
Rice Cisd 2 $10,000
James Patrick Patterson 1 $10,000
Texas Tech University System 2 $10,000
Mitchell B Todd 2 $10,000
Learner Centered Designs Llc Dba 2 $10,000
Inform Usa 2 $10,000
Megan Aghazadian Dba Loom Consulting 3 $10,000
Bookreport Llc 1 $10,000
Alamo Heights Isd 2 $9,987
Owyhee Air Research Llc 1 $9,963
Interactive Communications Solutions Group Inc 1 $9,935
Texas Center For Child And Family Studies 1 $9,925
Michelle Parsons 4 $9,924
Thrower Design Llc 1 $9,915
Hypha Usa Inc 1 $9,900
Adam Niedrpruem 1 $9,900
Lisa Loughney 1 $9,900
Fire And Materials Research Laboratory Llc 1 $9,900
Delores A Nornberg 1 $9,900
Jd Advisory Group 1 $9,900
Weaver Government Solutions 1 $9,900
New Path Accountability Llp 1 $9,900
Vitalsmarts Lc Dba Crucial Learning 1 $9,867
State Preservation Board 1 $9,860
Yolanda C Leyva 7 $9,846
Gene L Needles Jr 3 $9,836
Tru Buyer Llc Dba Trued Consulting Llc 6 $9,809
Us Anesthesia Partners Of Texas Pa 2 $9,801
Ryan Bailey 3 $9,799
Bellville Isd 2 $9,794
Jose Hernandez 6 $9,752
Robert Stanley Guevara 3 $9,750
Algis Baliunas 26 $9,750
Charles Henley 5 $9,675
The Law Office Of Joseph J Clement 17 $9,630
David M Ambrose 2 $9,625
Tarkington Isd 2 $9,621
Blue To Gold Llc 1 $9,600
Garza/Gonzalez & Associates Llc 1 $9,600
Fincher Engineering Llc 1 $9,600
Dominic Maneen 1 $9,584
Bloomington Isd 2 $9,512
Sukha International 1 $9,500
Charles Stearman 2 $9,500
Thermo Labsystems Inc 1 $9,500
Rebecca Vance-Charles 1 $9,500
Energy Worldnet Llc 1 $9,499
The Empowered Therapist Llc 1 $9,497
Purrington Moody Weil Llp 2 $9,476
Evolution Academy Charter School 2 $9,452
Globalscope Communications 6 $9,450
Danya L Greider 3 $9,439
Lance C Cox 3 $9,365
Central Texas Telephone Cooperative Inc Dba 1 $9,338
Kendall Moore 4 $9,325
Taft Isd 2 $9,321
Mann Law Firm Pllc 30 $9,292
Clement And Murphy Pllc 2 $9,250
Baird Hampton & Brown Inc 1 $9,250
Emergency Management And Response 3 $9,247
Liberty-Eylau Isd 2 $9,241
Cornell Gerger Consulting 1 $9,213
Liberty Isd 1 $9,210
Cintas Corporation No 2 5 $9,201
Richard S Simmons 24 $9,180
John Delatorre 7 $9,150
Marlon Runnels 7 $9,140
Kemble White Iv 2 $9,090
Nora K Conroy 5 $9,075
Tara Johnston 9 $9,075
Ruby Munoz Dang 3 $9,060
Douglas Lloyd Simon 8 $9,059
United Regional Physician Group 6 $9,038
Juan R Osteguin Iii 7 $9,037
Cathy Thomas 2 $9,000
Valencia Ashley Dba Purple Possibilities Llc 5 $9,000
Emery C Huber Od Pa 5 $9,000
The Mandt System Inc 1 $8,985
Bts Breakthru Training Solutions Inc 1 $8,950
Avi Systems Inc Dba Forte 2 $8,926
David Randall 4 $8,908
Kandilyn K Ash Attorney At Law 26 $8,870
Marshall Isd 2 $8,869
Alpash Patel 6 $8,850
Devine Isd 2 $8,812
Ace Alsup Iii 5 $8,800
Tasscc 3 $8,800
William P Taylor Md 5 $8,800
Ifi A Iloani 7 $8,768
Wallbuilder Presentations Inc 6 $8,762
Mourtgos Consulting Llc 2 $8,750
Alliance Engineering Group Inc 1 $8,750
Benjamin Goss 3 $8,700
Arthur J White Iii 17 $8,697
David Rider 3 $8,645
Lightspoke Llc 6 $8,640
E Quality Corporation 1 $8,640
Expanding Possibilities Inc 3 $8,640
Certified Staffing Solutions Inc 6 $8,635
Jordan Adams 4 $8,616
Texas Oncology Pa Diag Imaging 9 $8,607
Baker & Botts Llp 2 $8,588
Roberta Blaha 2 $8,501
Goldcal Llc 1 $8,500
Wild West Wildlife Rehabilitation Center 5 $8,500
Assurex Health Inc 2 $8,500
Jennifer Ayers 3 $8,500
Susan Atherton Hanson 1 $8,478
Frances Nwora 6 $8,450
Pearsall Independent School District 1 $8,432
Chazzah Sight Solutions Llc 9 $8,415
Gerlyn M Friesenhahn 25 $8,400
Michael Gomez 1 $8,400
Hightech Signs 1 $8,397
The Mendicant Architect Llc 1 $8,397
Michael B Lewis 25 $8,380
Kon Ventures Llc 3 $8,369
Keystone Partners Llc 1 $8,350
Psychotherapy Services & Yokefellows Pc 6 $8,337
Texas Council Of Child Welfare Boards 2 $8,333
Advancing States Inc 3 $8,332
Dlt Solutions Llc 1 $8,306
Stone Imaging Llc 8 $8,300
Emmanuel Asiriuwa 4 $8,250
Aaron H Wright 2 $8,250
Adeze Bethea 9 $8,221
Cincinnati Childrens Hospital Medical Center 1 $8,200
La Feria Isd 2 $8,190
City Of Mexia 7 $8,169
Kim L Hunt 7 $8,155
Eyemart Express Llc 5 $8,133
Vernon Independent School District 2 $8,131
John Penney Ii Electrical Inc 2 $8,115
Peacekeeping Institute Llc 2 $8,090
Hospice Of Wichita Falls Inc 1 $8,061
Michael William Hubbard 19 $8,060
Ashley Gonzalez Md 6 $8,050
Mep Engineering Inc Bldg 1 Ste 150 1 $8,025
Janna S And Company 4 $8,000
Richard Veglia Dpm Pc 4 $8,000
Eagle Environmental Services Inc 1 $8,000
Law Office Of Adam D Rowins 20 $8,000
Special Education Solutions Llc 1 $8,000
Avis Geer Wukasch 3 $8,000
Engaging Places Llc 3 $8,000
Ravan B Inc 2 $8,000
Personality Profile Solutions Llc 2 $7,990
Uncharted Territory Llc 6 $7,954
William D Defoyd 11 $7,951
X-Ray On Wheels Inc 2 $7,942
Kevin Sullivan Communications 1 $7,922
Shawn Tazusa Kataoka Matsumoto 4 $7,920
American Lung Association 2 $7,900
Rene Barrera 2 $7,875
Natalie Lauren Van Der Dys 6 $7,875
Texas A&M University College Of Veterinary Med 1 $7,809
National Grants Management Association 3 $7,805
Medical Arts Surgery Center 3 $7,803
Mark Iii Systems Government Solutions Llc 2 $7,800
Lion Star Nacogdoches Hospital Llc 1 $7,800
Jodi L Brown 19 $7,800
Briggs Equipment Inc 1 $7,750
Anchor Computer Inc 6 $7,749
Bret Ford Eye Care Pc 3 $7,722
Vertigis North America Ltd 6 $7,678
Tidehaven Isd 2 $7,676
Tekgration Llc 1 $7,656
Lidia Dailey 8 $7,637
Viking Enterprises Inc 1 $7,558
Robinson Duffy & Barnard Llp 6 $7,550
University Of Texas Austin 5 $7,546
Robert Charles Koons 3 $7,500
Elastec Inc 2 $7,500
Kathryn Ann Rogers 3 $7,500
Robinson Isd 2 $7,500
Management Systems Inc 1 $7,499
Lucy James 7 $7,395
Hardin Independent School District 2 $7,370
Attorney General 1 $7,360
Kdm Consults Llc 2 $7,350
Sealy Isd 2 $7,343
Loree Rae Bruton 7 $7,339
Global Financial Aid Services Inc 1 $7,329
Seminole Independent School District 2 $7,315
Henderson Hospital Llc 1 $7,237
Olney Isd 2 $7,203
Hager Health Llc 9 $7,202
Engineered Air Balance Co Inc 2 $7,200
Apex Realty Advisors 6 $7,200
Edward A Makler 5 $7,200
Health Care Compliance Association 4 $7,141
Alva J Winston P C 17 $7,126
Center Point Isd 2 $7,050
Elizabeth A Settle 15 $7,042
Rosemary R Simpson 12 $7,016
Dimmitt I S D 2 $7,016
Van Vleck Isd 2 $7,002
Kenneth Lance Hargrave 5 $7,000
Brian W Watts 1 $7,000
At Home Foot Care Pllc 5 $7,000
Rays Of Hope Llc 1 $7,000
Blx Group Llc 3 $7,000
Thompson Appraisal Services Inc 7 $7,000
Concho Valley Family Dental Pa 6 $6,952
Holly J Cooperroell 18 $6,950
Ryan L Matuska 12 $6,920
Association Of Certified Fraud Examiners Inc 5 $6,916
Stuart A Terry Md Pa 3 $6,913
Belmero Inc 13 $6,909
Signal Bridge Communication Inc 1 $6,900
Cedar Hill Isd 1 $6,878
Shannon Ladwan Keaton 3 $6,851
Todd R Smith Od 6 $6,818
Barry Mcgee 20 $6,818
Patrick Oconnor Keel 2 $6,800
Henderson Isd 1 $6,786
Neurorehabilitation Specialists Pllc 1 $6,771
Vienna Creative 2 $6,769
Calera Inc 6 $6,753
Janita Gilliam 5 $6,750
Berla Corporation 2 $6,750
West Isd 2 $6,705
Beacon Training Services Inc 2 $6,655
Powers Brown Architecture Na Llc 1 $6,644
Radiology Associates Of Wichita Falls Pa 9 $6,631
Atd 1 $6,615
Robert William Snider 3 $6,600
Perryton I S D 2 $6,582
John Wier 1 $6,580
K Friese & Associates Llc 2 $6,540
Galveston Bay Foundation 3 $6,539
Leadership And Personal Development Academy 1 $6,500
Pesi Inc 5 $6,496
Kane Russel Coleman Logan Pc 5 $6,480
Greater Houston Psychological Institute Inc 1 $6,413
Douglas P Felske 10 $6,400
Texas Department Of Public Safety 15 $6,386
Stephenville Isd 1 $6,382
Connie Z Kelly Pc 17 $6,375
Bradley J Merritt 3 $6,364
Adonna Faciane 8 $6,360
Todd Radford 2 $6,329
Rhoda Appiah-Boateng 22 $6,320
The Christian Law Firm Pllc 15 $6,314
Lone Star Endoscopy Of Austin Pllc 1 $6,309
Refugio Independent School District 1 $6,305
Byron B Hinton 3 $6,300
Hl4 Billing Llc 21 $6,300
Ys Orthopedics Pllc 7 $6,300
Nacogdoches Pulmonary And Sleep Associates Pa 4 $6,300
Raven Environmental Services Inc 1 $6,275
Vrl San Antonio Llc 1 $6,268
Ward Beecher Dc 15 $6,265
Orangefield Isd 3 $6,252
Las Lomas Land Company Llc 1 $6,250
Leonel Garza Iii 1 $6,250
William P Tansey 1 $6,250
Journal Technologies Inc 2 $6,200
King Vet Llc 4 $6,188
Lemoine Disaster Reocvery Llc 2 $6,178
Thomas B Coopwood Ii 25 $6,150
Bywater Solutions Llc 2 $6,134
Andrews And Associates It Solutions 3 $6,132
Mbj Medical Consulting Pa 8 $6,113
Jonathan Hawley Dds Pllc 1 $6,097
Joseph J Padian 7 $6,096
Elgin Independent School District 1 $6,055
Gilpin Engineering Llc 1 $6,044
Texas Therapy Specialists Llc 4 $6,038
Brazos Valley Foot Care Pa 5 $6,000
West Plains Veterinary Hospital Ltd 3 $6,000
Parker Cpe Llc 1 $6,000
Jacquelene Caldwell 4 $6,000
Stephanie Evergreen 2 $6,000
Texas Water Foundation 2 $6,000
Paramount Cardiovascular Associates 3 $6,000
Zeytech Inc 1 $6,000
Steven Snell 1 $6,000
Research Planning Inc 1 $6,000
Variate 1 $6,000
Electra Memorial Hospital 3 $6,000
Bay City Isd 1 $5,989
Joseph Parks 6 $5,958
Brownwood Isd 1 $5,955
Harshil Patel Dds Pllc 18 $5,950
360 Vision Pa 9 $5,950
Sheryl Victorian 5 $5,943
Hurt Jacknow Moore Connor Wells Michels Yurco 20 $5,918
Elaine Davis 6 $5,890
Indoor Environmental Consultants Inc 1 $5,885
Alaina Webb 6 $5,880
City Of Brownwood 1 $5,848
Central Plains Center For 6 $5,822
Nocona Isd 2 $5,802
David Cox 20 $5,775
Rio Occupational Institute Llc 13 $5,725
The Wilkins Group Inc 5 $5,725
Fay E Simon 24 $5,700
Noshir Contractor 1 $5,695
Us Bank Trust Company National Association 4 $5,678
Anahuac Isd 1 $5,651
Lab Direct Llc 5 $5,616
Naples Neuropsychology Pa 2 $5,600
North Lamar Isd 2 $5,590
Stockdale I S D 1 $5,570
Fbi- Leeda 8 $5,565
Prime Medical Testing Inc 10 $5,545
Brenham I S D 2 $5,540
Noresco Llc 6 $5,536
Xello Inc 1 $5,526
Mayra Mora 11 $5,514
Mercedes Isd 1 $5,512
Martha Gayle Reid Lynch 1 $5,500
Good News Management Ltd 2 $5,500
Mitchell Etter 1 $5,500
Exam Works Llc 2 $5,500
Goliad Isd 1 $5,499
Allone Health Well Llc 6 $5,496
Jason Schechterle 1 $5,475
Seymour Isd 2 $5,468
Apex Edi Inc 8 $5,465
Examworks Llc 3 $5,450
William J Deaton Md 3 $5,400
Abilene Independent School District 2 $5,400
Skidmore-Tynan Isd 2 $5,387
Tom Quinones Attorney At Law P C 14 $5,386
Beyond Lucid Technologies Inc 1 $5,368
Galia Cohen 4 $5,364
Stephen G Sireci 1 $5,350
James W Pellegrino 1 $5,350
Andrew Dean Ho 1 $5,350
Ye Tong 1 $5,350
Alison Louise Bailey 1 $5,350
Bastrop Isd 2 $5,336
Genie Healthcare Inc 3 $5,262
Juniper Land Planning Llc 1 $5,250
Christopher N Ruszkowski 1 $5,243
Sareena Ghulafi Wildberger 10 $5,225
James Stephen Tittle 15 $5,220
Morgan Podiatry Pa 2 $5,190
Bdo Mexico City 6 $5,147
Simon J Forster 6 $5,100
Peter Delvecchia Cpa Pllc 1 $5,100
Edminster Hinshaw Russ & Associates Inc 1 $5,085
Vhs San Antonio Imaging Partners Lp 9 $5,059
Kountze Independent School District 1 $5,054
Eli Cummings Dc 1 $5,040
Ulliance Inc 1 $5,000
Bishop Consolidated Independent School District 1 $5,000
Sandy Hook Promise Foundation 5 $5,000
Richard Tilden Levene 2 $5,000
Georgetown Independent School District 1 $5,000
Patriot3 Inc 1 $5,000
Gray Reed Advisory Services Llc 1 $5,000
Kierstan Michelle Barbee 1 $5,000
Focusworks Consulting Group Llc 1 $5,000
Engage Llc 2 $5,000
Shaw Polygraph Service Inc 1 $4,995
Bdi Datalynk Llc 1 $4,990
Mccrone Research Institute 2 $4,990
Zenithlane Llc 2 $4,980
The Randall Group 911 3 $4,980
Hall Consulting Inc 1 $4,950
Neil Grieshop 24 $4,950
David I Tasker Mdpa 24 $4,950
Joris Kerckhof 1 $4,918
Rita Lee Wedgeworth 4 $4,910
Kerrtulla Llc 1 $4,907
National Association Of State Facilities Administr 2 $4,900
Gina L B Minks 2 $4,875
Jeffrey C Lee 1 $4,871
Otise Reed 3 $4,820
Guard-It Corporation 3 $4,800
Levi Williams 3 $4,800
Radiation Solutions Inc 1 $4,800
Chi Brander Inc 1 $4,800
Vanessa Fawn Colburn 2 $4,760
E3 Professional Trainers Llc 1 $4,750
New Horizons Learning Llc Dba New Horizons 5 $4,739
Brown And Peisch Pllc 1 $4,725
Jared E Williams Dds Professional Limited 15 $4,725
Evisions Inc 3 $4,711
Tyco Technology Gmbh 1 $4,702
Chiquia Roberson 24 $4,666
Gregory J Cizek 1 $4,650
Martha Thurlow 1 $4,650
Enso Coaching & Consulting Llc 4 $4,650
Alison Leston 15 $4,650
Jeffrey S Richards 23 $4,650
Leonor B Frierson-Stroud 17 $4,650
University Of Texas Law 7 $4,644
Texas Foundation For Maternal Infant And Lactati 2 $4,628
Perlex Legal Pllc 14 $4,627
Gk Holdings Inc 1 $4,625
Rad X Mobile Imaging Llc 1 $4,620
Ksa Dynamics 2 $4,600
Iceeft 1 $4,580
Milton Hixson 3 $4,580
Edgewood Isd 1 $4,572
Nhcaa Institute For Health Care Fraud Prevention 2 $4,550
Luis Pacheco 6 $4,530
Schulman Lopez Hoffer & Adelstein Llp 1 $4,518
Newton Isd 2 $4,517
Olshan Ark-La-Tx-Lp 1 $4,500
Bryan Sky-Eagle Pllc 2 $4,500
Consumer Credit Counseling Service Of 4 $4,500
Tommy Ray Rials Jr 1 $4,500
Atrium Real Estate Services 2 $4,500
Anna Marie Rampy 2 $4,500
Tg8 Llc 1 $4,500
Danielle Sanders 2 $4,500
Jonathan Richard Mattingly 1 $4,500
Austin Radiological Association 4 $4,493
North America Association Of Central Cancer Regis 4 $4,478
Thomas E Weissler Od 3 $4,470
Head & Neck Surgical Associates Pllc 6 $4,462
The Bavi Law Firm Pllc 5 $4,460
Linden-Kildare Cisd 2 $4,443
Ken D Mindell 3 $4,433
John Andrew Prisner 12 $4,431
Ut-Austin School Of Social Work 3 $4,427
Current Technologies Computer Learning Center 1 $4,395
Frederick L Mcguire 1 $4,395
Pamela Gonzalez 1 $4,390
Green Apple Holdings Llc 1 $4,378
Diane M Ewing 1 $4,368
Boles Isd 2 $4,357
Marys Clinic Inc 6 $4,325
Kelly L King 6 $4,305
Allyson Collins 5 $4,300
Conexig Llc 1 $4,300
Independent Physicians Network Pllc 2 $4,275
Mobile Cr Imaging Llc 2 $4,256
Absolute Urgent Care Inc 2 $4,255
Susan Tims 7 $4,217
Little Cypress-Mauriceville Isd 1 $4,202
William Howze 1 $4,200
Arin Bryan 1 $4,200
Bilal Ismail 22 $4,200
Brandy Miller Phd Pc 2 $4,200
2besuccessful Llc 1 $4,200
Sch Direction Llc 8 $4,188
Confidence Unchained Llc 1 $4,169
Lone Star Urology Pllc 3 $4,163
Texas Coastal Bend Pulmonary & Critical Care Assoc 5 $4,163
Lone Star Orthopedics Pa 9 $4,126
Honesty Environmental Services Inc 2 $4,124
Lamberto Balli 1 $4,124
Athill Muhammad Attorney At Law 4 $4,100
Texas State Affordable Housing Corporation 1 $4,095
Fpog Llc 10 $4,085
P3 Specialized Training Llc 4 $4,080
Neurodiagnostic Center Pa 2 $4,080
Kara Pittman 1 $4,050
Alfred T Denham 5 $4,050
Southwestern Exposition And Livestock Show 1 $4,026
Ann Marie Carrizales 1 $4,008
John Gregory George Jr 1 $4,000
Brian E Francis 2 $4,000
Kristen Mclean 2 $4,000
Mark A Barinque Dpm Pa 1 $4,000
Erad Group Llc 1 $4,000
Allison Davis Maxon 1 $4,000
Ee Water Company Llc 1 $3,996
Joseph Clements 1 $3,967
Robert Coleman Foster 1 $3,950
Orange Grove Isd 2 $3,927
Vincent Morin Jr 2 $3,925
Sylvester G Ramirez Md Pllc 3 $3,924
Vitalsmarts Lc 2 $3,922
Arlene M Gay 4 $3,920
International Association Of Insurance Receivers 3 $3,900
Fiberlight Llc 4 $3,900
Mineola Isd 1 $3,894
Infosight Inc 1 $3,890
Rcm Training And Consulting Llc 4 $3,876
Prasad Maddukuri Md Pllc 8 $3,858
Michael Gentry 3 $3,844
Campbell Isd 2 $3,823
Thomas D Pearce-Ilead Consulting & Training 1 $3,812
Melissa Scheinfeld 1 $3,800
Mirarchi Management Group 2 $3,796
Community Isd 1 $3,796
South Texas Emergency Care Foundation Inc 2 $3,788
Alisa Hays Mcdonald 1 $3,772
Ebony M Turner 10 $3,761
Deer Oaks Eap Services 19 $3,755
Gulf Coast Council Of La Raza Inc 1 $3,754
Bbc Entrepreneurial Training & Consulting Llc 1 $3,750
Stacy V Smith 23 $3,750
Michelle Anchondo Mosley 1 $3,750
Levitt Consulting Group Llc 1 $3,750
Medical Office Of R David Bauer Md Pa 8 $3,750
Spur Veterinary Hospital 1 $3,723
Govind Nadkarni Pe 2 $3,721
Contour Collective Llc 3 $3,700
Jens Figlus 1 $3,700
Christopher P Hornsby 2 $3,675
Law Offices Of Ken Ramirez Pllc 3 $3,675
Sheila Weathers 1 $3,650
University Of Texas Health Science Ctr 2 $3,650
The Opara Law Firm Pllc 2 $3,620
Cpr Aed Course Llc 4 $3,608
La Grange Independent School District 1 $3,607
Wayne J Camara 1 $3,600
Broadleaf It Llc Dba Broadleaf Group 1 $3,600
Measurement In Practice Llc 1 $3,600
Robert T Garbacz 8 $3,596
Teracom Training Institute 1 $3,591
American Association Of Post-Acute Care Nursing 4 $3,580
Jon Edwin Hodde 1 $3,563
Melody Lynn Jones Hull 5 $3,545
Masters Advanced Remediation Services Llc 1 $3,519
Crisis Prevention Institute Inc 2 $3,513
Lovejoy Isd 2 $3,506
Robert B Peak 3 $3,500
San Diego State University Foundation 2 $3,500
Joseph M Coffey 2 $3,500
Improv Productions Llc 1 $3,500
Lbj School Of Public Affairs 1 $3,500
Association For The Advancement Of Mexican- 2 $3,480
Troup Isd 2 $3,477
Dominion Ambulance Llc 1 $3,472
Inceptia 4 $3,465
Karina Sofia De Leon 2 $3,458
Azreena B Thomas 16 $3,450
Magna Legal Services Llc 2 $3,437
Trinity Basin Preparatory Inc 1 $3,408
National Conf Of State Legislature 1 $3,400
Diane Lide 4 $3,388
Bland Isd 2 $3,381
Mov Training Services Llc 2 $3,360
Charlotte Isd 1 $3,359
Efi Global Inc 3 $3,355
Uthscsa Dental School 5 $3,341
Lake Dallas Isd 2 $3,335
Keith Jemison 4 $3,335
Martha Manley Malik 12 $3,325
Alpine Isd 2 $3,319
Kevin L Tomsic 21 $3,300
The Management Action Center 2 $3,300
Gladiator Forensics Llc 1 $3,300
Schroeder Valuations Llc 1 $3,300
W Ryan Butler 18 $3,300
Noah K Kaufman Phd 6 $3,300
Tmc Provider Group Pllc 4 $3,269
Neely Behavioral Health 6 $3,261
Lois E Bingham 3 $3,250
National Institute For Trial Advocacy 1 $3,245
Mary E Grisba-King 9 $3,240
Firetrol Protection Systems Inc 1 $3,220
Andrew T Young 1 $3,220
Gulf Coast Emergency Physicians Pllc 1 $3,207
George I Martinez 1 $3,200
E&C Engineers & Consultants Inc 2 $3,200
Gerimed Ltc Network Inc 1 $3,200
University Of Houston Treasures Office 1 $3,200
The Glenn Group Llc Dba Fastsigns 1 $3,199
El Campo Isd 1 $3,194
Dr Arthur D Shaw 12 $3,150
Alliance Health Resources Mobile Division Ltd 4 $3,145
Russel C Nemky 1 $3,142
William Davey Edwards 2 $3,142
Aed123 Llc 8 $3,117
Dietary Solutions Inc 6 $3,111
Paul L Valenza Dpm 3 $3,104
Rogers Isd 2 $3,087
Aehs Inc 4 $3,075
Snyder Isd 2 $3,071
Martin County Hospital District 8 $3,047
Printmailpro Ltd 1 $3,028
Linette B Melcher Mdpa 7 $3,022
William Wells 1 $3,017
Eric F O'Neill 14 $3,000
Fort Bend Pulmonology Pllc 3 $3,000
Metropolitan Forensic & Neuropsychological Consult 1 $3,000
Cadre A Program Of Direction Service Inc 1 $3,000
Dr Tania Glenn & Associates Pa 1 $3,000
Adults & Youth United Development Association I 1 $3,000
Courtesy Consulting Llc 1 $3,000
Texas Water Foundation Inc 1 $3,000
Agile Sports Technologies Inc Dba Hudl 1 $3,000
Clark Adr Pllc 3 $3,000
Paso Del Norte Center Of Hope 1 $3,000
Ccmnt Speakers Llc 1 $3,000
Diversified Communications 2 $2,995
Internal Revenue Service 1 $2,994
Texas Tech University Health Science Center 18 $2,989
Wayne M Parks 1 $2,981
Ll Global Inc 5 $2,980
Carmen P Smith 13 $2,975
David C Rainwater 14 $2,975
Hondo Isd 2 $2,972
Foundation For Trusted Identity 4 $2,965
Law Offices Of Grace N Nwanguma Pc 7 $2,948
Curtis Howard 3 $2,903
American Water Works Association 1 $2,900
Mark Ash 6 $2,900
O'Reilly Media Inc 3 $2,893
Employee Services Llc 1 $2,875
Presidio Isd 3 $2,865
Skg Engineering Llc 1 $2,865
Osborne Therapy Services Llc 2 $2,858
Macwatson Enterprises Inc 2 $2,848
Billy Tidwell 4 $2,826
Roxana Burris 2 $2,813
Crane Independent School District 2 $2,805
Texas Public Finance Authority 3 $2,804
American Public Human Services Association 2 $2,800
Marianna Konradi Od Pllc 3 $2,800
Aapc Holdings Llc 1 $2,788
Martin Vasquez 5 $2,785
Subrenna S Turner 1 $2,785
Yolanda Jurado-Gesswein 8 $2,781
Johnson Roberts & Associates Inc 1 $2,775
Mexia Vision Services Pa 9 $2,765
Spalding Nichols Lamp Langlois 1 $2,763
University Of Texas School Of Law 3 $2,756
The Linux Foundation 1 $2,750
Mehrnaz Iranmehr 1 $2,750
Fbi National Academy Associates (Fbinaa) 2 $2,750
Risinger Veterinary Hospital 14 $2,741
Archive Supplies Inc 1 $2,729
Icaught Incorporated 1 $2,720
John H Malcom Jr 2 $2,700
Texas Assoc Of Property & Edidence 1 $2,700
Legislative Budget Board 11 $2,700
Matthew Mendel Phd Pc 1 $2,700
Mfl Marketing Corporation 1 $2,700
Tara Flannery Photography Llc 1 $2,700
Rgv Cpr Llc 1 $2,700
William F Strong 1 $2,700
Donald C Morris Jr 7 $2,692
Odem-Edroy Isd 2 $2,690
Lisa M Salazar 1 $2,650
Justfoia Inc 1 $2,645
Education Service Center Region Xiii 2 $2,645
Region 19 Education Service Center 6 $2,625
Feldesman Llp 3 $2,604
Stephen Dye 2 $2,598
Simplify Compliance Holdings Llc 1 $2,573
Tamisha Delvaille 5 $2,560
Blooming Buds Therapy Llc 4 $2,551
Audrey Nath Md Pllc 16 $2,550
Central Texas Alternative Dispute Resolution Inc 1 $2,550
Richard B Levinson 1 $2,550
Gebco Associates Lp 5 $2,550
Polanco Enterprises Inc 6 $2,540
Texas Agrilife Extension Service 7 $2,523
Nelda Faye Harris 5 $2,520
Ehs Compliance Services Rd 1 $2,520
Greater Houston Fire Marshal'S Council 1 $2,500
Merkel Independent School District 2 $2,500
Galen F Morrison 1 $2,500
Kristin Matulka 1 $2,500
Elia Hernandez Moreno 1 $2,500
Academic Life Simplified Llc 1 $2,500
Edward Dawson 2 $2,500
Jessica S Freud 3 $2,500
Bipsync Ltd 1 $2,500
Cornish Medical Electronics 2 $2,495
Knowledge Academy Inc 1 $2,495
The Myers Briggs Company 1 $2,493
Glenn C Jordan 2 $2,490
Diligent Delivery Systems 24 $2,480
David Yebra 3 $2,480
M & S Radiology Associates Pa 10 $2,467
Emily Bower 1 $2,442
National Association Of Social Workers 2 $2,441
Kristine Padrique Brown 5 $2,430
James Coker 1 $2,420
Lsps Solutions Llc 1 $2,408
Sanjay Aggarwal Mdpa 6 $2,400
American Dynamic Imaging Ltd 4 $2,400
Manasseh Medical Imaging Inc 4 $2,400
Alliance Health Partners Pllc 2 $2,400
Alavie Interventional Pain Management Pllc 5 $2,395
Comptroller Of Public Accounts 7 $2,359
Blum Isd 2 $2,358
Iowa Park Independent School Dist 2 $2,358
Inner Corridor Technologies Inc 2 $2,355
The Ocular Surgery Center Pa 1 $2,342
Susan E Grona 3 $2,325
Fei Jiang 1 $2,305
Pulse Media Inc Dba Lumenbrite Training 1 $2,288
Pictographix Inc 1 $2,287
Wellness Counseling Center Of Texas Llc 5 $2,280
Toby J Glaser 3 $2,275
Brandy Bannister 9 $2,275
David H Wilhite Dds 11 $2,275
Driscoll Isd 2 $2,269
Texas Administrators Of Continuing Education For 1 $2,250
The Leaders Institute Llc 1 $2,250
Fred Louis Speck Jr Md 12 $2,249
Anthony J Holcomb Dvm 2 $2,241
Allan S Ganesh Dpm Pllc 1 $2,240
Laurynn Mcgowen 7 $2,230
Trenton R Marshall 11 $2,210
Cintas Corporation No2 1 $2,205
Barbara L Sutherland 4 $2,205
Pragmatic Institute Llc 1 $2,200
Inform Tech Holdings Llc 1 $2,199
Illumeo Inc 1 $2,189
Hudson Independent School District 1 $2,164
Behavioral Tech Institute 2 $2,150
Grafton School Inc 2 $2,144
David Alvarado Dc Pc 9 $2,139
Macario Tristan 2 $2,134
San Antonio Childrens Surgical Llc 1 $2,103
Michele M Bishop 7 $2,100
Bob C Hunsucker 9 $2,100
Randall D Meyer 10 $2,100
Catalina Zambrano-Martinez 6 $2,100
Matthew T Palmer 10 $2,100
Chopra Imaging Centers Inc 3 $2,087
Equipment Depot Ltd 2 $2,075
Bridget Moore 1 $2,059
Karen K Garza 1 $2,056
Eric Metcalf 2 $2,051
Good Seed Therapies Llc 2 $2,050
Thien-Kim Pham 6 $2,050
Curators Of The University Of Missouri 1 $2,046
Mesquite Neurology Clinic Pa 7 $2,033
Klasey Consulting Llc 1 $2,031
Buck Law Firm Pllc 6 $2,030
Kyle E Jones Mdpa 4 $2,025
Hook And Eye 1 $2,020
Incontrol Technologies Llc 1 $2,016
West Texas Rehabilitation Center 4 $2,010
Del Carmen Consulting 2 $2,007
Ross Gannaway Pllc 2 $2,006
Morris Bell 1 $2,000
Media Verification Inc 1 $2,000
Ashish Raj 1 $2,000
Suzanne Carlton Hart 1 $2,000
Firas Kobaissy 1 $2,000
William C Morris 1 $2,000
James Lane Air Conditioning Company Inc 1 $2,000
William Loving 4 $2,000
D-Degree Coaching And Training Llc 1 $2,000
Carpenter Veterinary Clinic Pllc 1 $2,000
David Kerby 1 $2,000
Healthy Eyes Vision Center Pa 1 $2,000
Adminmonitor Llc 1 $2,000
Veterinary Hospital Of New Waverly Pllc 1 $2,000
Lawrence Ragan Communications Inc 1 $1,999
1531073 Alberta Ltd 1 $1,995
Sti Spfa 2 $1,995
Fisherbroyles Llp 1 $1,990
Pathologists Bio Medical Labs 6 $1,985
Pro Wellness Services Pllc 2 $1,972
Steerus Inc 1 $1,968
University Of Texas 5 $1,961
Austin Bar Association 2 $1,960
Obinna Oc Iloani 4 $1,959
Texas Background Investigations Llp 2 $1,950
Leana Baggett Talbott 1 $1,950
Ojeponle Durojaiye 7 $1,950
Emailable Llc 1 $1,950
Procore Training Llc 1 $1,940
Thomas Omar Oei Mdpa 3 $1,935
Gary Pillers 10 $1,925
Niraj Patel 4 $1,925
Usaging 1 $1,910
Sparq Data Solutions Inc 4 $1,900
Gary Brown & Associates 1 $1,900
Texas Bicycle Coalition Education Fund 1 $1,900
Julia Sheffield 1 $1,900
Lakeside Mediation Center 1 $1,900
Galton Cunningham & Bourgeois Pllc 2 $1,900
International Ombudsman Association (Ioa) 1 $1,895
Holistic Care Ems Llc 1 $1,879
Christopher Cook 2 $1,875
Alesa N Rabson 1 $1,872
Propath Associates 6 $1,867
Bexar County Hospital Dist 8 $1,865
Trawood Family Dental Pllc 4 $1,860
Digitelligent Inc 2 $1,855
Bridgewood Appraisal Group 1 $1,850
Cooperative Personnel Services 1 $1,845
County Of Bexar 1 $1,838
Travis County Clerk'S Office 1 $1,836
Charles Mais Jr 3 $1,830
Steven J Hernandez 2 $1,825
Superior Shuttle Llc 2 $1,821
Integrative Emergency Srvc Phys Grp Houston Pllc 2 $1,803
Roadrunner Radiology Equipment Llc 1 $1,800
Unc Chapel Hill 1 $1,800
Brian W Zale Dpm 1 $1,800
Mobotrex Inc 1 $1,800
Lehna Sema Llc 1 $1,800
Kirby Turner 8 $1,800
Stacy Norrell 9 $1,800
Dawn Matocha 2 $1,800
Yangpei Cao D D S Pllc 2 $1,775
Carol Evans 7 $1,750
Kenneth L Sherman 1 $1,750
Darcy Deno 4 $1,740
Lela Farmer 5 $1,725
Texas Health Presbyterian Hospital Denton 4 $1,716
Energy And Environmental Advisors Inc 4 $1,710
Hudson Werner Horn Karnik Douglas & Hummer Pa 2 $1,710
The Lawrence Group Architects Of Austin Inc 1 $1,710
Rcn Communications Llc Dba Rcn Technologies 1 $1,707
Kelley Pennell 1 $1,706
Vanessa C Cantu Pllc 2 $1,700
Abundans Information Technology Llc 1 $1,700
Omnicare Pharmacy Of Texas 1 Lp 4 $1,691
Vanish Document Shredding Inc 2 $1,680
Park Place Publications Lp 1 $1,680
Texas Health Presbyterian Hospital Dallas 1 $1,678
Reneau Rehab Inc 5 $1,671
Kelly West 11 $1,650
Harris Medical Consultants Llc 2 $1,642
Kowert-Hood-Munyon-Rankin & 1 $1,639
Linda Mitchell 1 $1,639
Holliday Isd 2 $1,635
Hub Optical Distributing Company Inc 3 $1,625
Ged Testing Service Llc 3 $1,625
Flora B Miranda-Aguilar 3 $1,615
Song Gao 2 $1,600
Fish Fish & Long 5 $1,600
Curtis D Chong 1 $1,600
Eyesite Family Vision Inc 3 $1,600
Melissa Y Baker 1 $1,599
Sherry R Wetsch 12 $1,599
Educate 360 Llc 3 $1,595
Cpr Resources Inc 2 $1,585
Paul Cordova 2 $1,585
Delton Thrasher 1 $1,581
Manda Rosser 2 $1,580
Douglas J Kappmeyer 2 $1,577
Olubusayo K Fasidi 2 $1,576
Brock Orthodontics 5 $1,575
Assn Of Certified Fraud Examiners 4 $1,575
Scott A Janse 8 $1,575
Health Level Seven International Inc 2 $1,575
Ngan Chi Doan 1 $1,574
Anderson Crane And Bridge Technologies 1 $1,570
Underwood Law Firm Pc 2 $1,560
Full Life Psychology Pllc 1 $1,555
Data Projections Inc 1 $1,550
Leticia Longmiles 2 $1,550
Vincent John Cavaretta Iii 2 $1,550
Texas Egineering Extension Service 1 $1,550
Joseph C Rest 1 $1,549
Ben Kilgore 3 $1,542
Doyle & Seelbach Pllc 4 $1,534
Jean Pierre Rwigema 2 $1,525
Miessha Jackson 1 $1,509
Jesus De La Teja 1 $1,500
Larry L Tyner Jr 1 $1,500
Real Wired Inc 6 $1,500
Morrissey Medical Llc 1 $1,500
Carolyn Carman 8 $1,500
Beyond The Gray Sky Llc Dba Pursuit Of Happiness 1 $1,500
Traliant Operating Llc 1 $1,500
Flatlands Dance Theatre Inc 1 $1,500
Chaunte White 1 $1,500
Assa Abloy Global Soluions Inc 1 $1,500
Rc&T/Emdr & Beyond 1 $1,500
Dr Eric Tiblier Pa 2 $1,500
City Of Vernon 2 $1,497
Spencer O Johnson 1 $1,495
Kevin A Lopez 1 $1,495
Tyler J Hobbs 1 $1,490
Harshi Bain S Mdpa 2 $1,490
Vanessa Stauffer Lvt Services Llc 2 $1,460
American Institute For Chartered Property Casualty 3 $1,454
Leslie Ching 1 $1,447
Steven K Alexander 3 $1,445
Lara Kennedy 1 $1,442
Auclair And Associates Pllc 8 $1,440
William W Voelter 2 $1,428
J And P Management Llc 4 $1,425
Ems Technology Solutions Llc 1 $1,425
The Institute Of Internal Auditors Inc 1 $1,422
Health Professions Council 15 $1,421
Hcaa Medical Group Pa 8 $1,405
Anc Valuations Inc 4 $1,400
Seyed Moein Seyed Sadrkhani 8 $1,400
Theresa Mclean 8 $1,400
Dr William Deaton 1 $1,400
Ryan Robertson 1 $1,400
Williamson County Childrens Advocacy Center Inc 1 $1,400
William R Phillips 7 $1,400
Geospatial Training Services Llc 1 $1,399
Ryan White Clinics For 340b Access 2 $1,398
Julie B Lovings 1 $1,387
Whitney Isd 2 $1,383
Texas Tech Univ Hsc El Paso 3 $1,350
Gregory T Miller 1 $1,350
Sloan Designs Llc 1 $1,350
Omonele Nwokolo 7 $1,350
Baccam Consulting Llc 3 $1,350
Island Health Center Pa 4 $1,330
Biomedical Engineering Technicians Inc 1 $1,330
Texas Association Of School Business Officials 1 $1,320
Calvin Plumb 3 $1,313
Coolidge I S D 1 $1,308
Training And Policy Development 3 $1,305
Yevette Christy Llc 2 $1,301
Matt Wylie 1 $1,301
Esparza & Garza Llp 1 $1,300
Doug Williford And Son 1 $1,300
Cloud Training Services 4 $1,295
Heart Of Texas Art Group Inc 2 $1,295
International Information System Security 1 $1,285
Kevin Lunsford 2 $1,280
Salado Isd 1 $1,250
The Univeristy Of Texas At Austin 1 $1,250
Quantum Success Solutions Llc 1 $1,250
Rains Isd 1 $1,250
Three Way Isd 1 $1,250
Its America 1 $1,250
New Boston Independent School District 1 $1,250
Wayne D Green Md Pa 6 $1,232
Root Canal Specialists Pa 1 $1,229
Pooria Fallah Abed 7 $1,225
Lucas Max Ebaugh 1 $1,225
Eva Stanley 7 $1,225
Petros Ministries Inc 2 $1,222
Landesign Services Inc 2 $1,220
Casey Mann 1 $1,219
Texas Commission On Law Enforcement 3 $1,210
Ryan M Winder 1 $1,210
Jason Johnson 1 $1,210
Edna Lucinda Salazar 1 $1,205
Shant Pezeshkian 6 $1,200
Friends Of Brazoria Wildlife Refuges 1 $1,200
Youngs Professional Services Llc 3 $1,200
Andrew Michael Schwarz 1 $1,200
Melissa Ann Hays 3 $1,200
Gcb Industries Llc 1 $1,200
Sage Fitness Llc 6 $1,200
Sylvia Adams 1 $1,200
Robinson Duffy And Barnard Llp 1 $1,200
Texas Tech Health Sciences Center 1 $1,200
Mayra G Guzman 1 $1,200
Timothy Ingram Llc 1 $1,200
Houston Interventional Cardiology Pa 2 $1,190
Park Contractors Inc 1 $1,190
Occuoational Health Centers Of The Southwest Pa 1 $1,188
Century Integrated Partners Inc 1 $1,186
The Nielsen Norman Group 1 $1,185
Advance Ems Ltd 3 $1,185
Vivify Creative Communications Inc 1 $1,175
Ryan Reyes 1 $1,175
W B Patterson Iv Dvm Pc 1 $1,171
Wichita County District Clerk 2 $1,170
Texas Health Center Pa 4 $1,170
Keene Isd 1 $1,170
Texas A&M Transportation Institute - Tti 1 $1,169
Ut Southwestern 4 $1,165
Jenny Henley 5 $1,161
Jerry R Ocker Dds 5 $1,152
Karen Rude 2 $1,150
Retina Specialists Of San Antonio Pllc 2 $1,149
Itasca Isd 1 $1,137
Drug Chek Llc 11 $1,125
Steve Yancey 2 $1,120
Advanced Development Methods Inc 1 $1,116
Texas Oncology Pa 4 $1,109
Coastal Bend Urgent Care Llc 2 $1,105
Stokes Psychological Services Pllc 1 $1,100
Julia Warren 3 $1,100
Belinda Mangum 1 $1,095
Ronald L Cook 2 $1,087
Friona Isd 1 $1,085
Electra Isd 1 $1,084
Wellness Counseling Center Of Texas 4 $1,080
Texas Medicine Resources Llp 6 $1,066
Dentate Pllc 2 $1,055
Mary Elizabeth Kuruvilla 6 $1,050
Enviro-Ag 4 $1,050
Devers Isd 1 $1,050
Kenneth Lance Hargrave Md 1 $1,050
Alexander Shau 5 $1,050
Jeffrey Brian Geno 6 $1,050
Leah Belsches 1 $1,050
John Buie Dds Pllc 6 $1,050
Proaction Inc 2 $1,050
Blythe Mansfield 1 $1,050
Jennifer Arnouville 6 $1,050
Crossroads Chiropractic Clinic 3 $1,045
Healthcare Express Llp 5 $1,042
Robert Negrin Md 1 $1,042
Brian Bush 1 $1,035
Spear & Lancaster Llc 3 $1,025
South Heart Clinic Pllc 2 $1,024
Barbara Saldana 3 $1,010
Scl Holdings Inc 1 $1,000
Patrice Sparks 1 $1,000
Momentum Is Balance Coaching And Partnership Llc 1 $1,000
Val Verde County Hospital District 1 $1,000
Daniel Mendiola 1 $1,000
Law Offices Of James & Stagg Pllc 1 $1,000
Sheila Burnett 1 $1,000
Salvatore A Barbaro Iii 1 $1,000
Ashleigh Kent 3 $1,000
Kevin Roy Hirschi 1 $1,000
Jamie R Wright Llc 1 $1,000
Charlie Nagle 1 $1,000
Macchian Solutions Llc 1 $1,000
Alison Jennifer Lee 1 $1,000
Law Office Of C S Hall Pllc 1 $1,000
Kind Mind Psychotherapy Pllc 1 $1,000
Amanda Holtzclaw 1 $1,000
Ecourtdate Inc 1 $1,000
Thomas A Cadenhead Mdpa 1 $1,000
Ssi Solutions Inc 4 $998
Pulmonary Services Of North Texas Pllc 3 $993
Longview Medical Center Lp 3 $990
The Law Office Of Alton James Iii Pllc 1 $980
Bruce Cresson 1 $975
Bac-Flo Unlimited Inc 1 $975
Periodent Pllc 1 $975
Cove Physical Rehab Llc 1 $975
Tri-County Clinical 1 $951
Tamar Maor 1 $950
Kenneth Scott Williams 1 $950
Southwest Texas Regional Advisory Council 1 $950
Erika June Canales 1 $950
Milt Wright & Associates Inc 1 $950
The West Texas Rehabilitation Center 1 $945
Wd Forensic Inc 1 $940
Heaton Ear Nose And Throat Associates Of East Texa 2 $940
Beaumont Family Practice Associates Pa 3 $936
Eastex Urgent Care Llc 7 $935
Jennifer Diane Martinez 1 $926
Michael S Lang 1 $926
Bethany Shrewsbury 3 $921
San Marcos Cisd 1 $916
National Association Of State Ems Officials 1 $915
Jason Liu Md Inc 2 $912
Valley Day And Night Clinic 1 $911
Bacy Law Pllc 2 $910
Lower Valley Dental Associates Pa 3 $908
John H Marshall 3 $907
Daniel M Roberts 6 $900
Jorge A Saravia Mdpa 1 $900
David A Marks Md Pa 5 $900
C C Lynch And Associates Inc 1 $900
Ut Md Anderson Cancer Center 1 $900
New Leaf Behavioral Health Llc 1 $900
Carlos R Orozco 1 $900
Sandra Liliana Oakes 1 $900
Enerdynamics Corp 1 $895
Appeon Inc 1 $895
Mason Central Appraisal District 1 $891
Courtyard By Marriott San Angelo 1 $890
Beverley Ling Rogers 4 $885
Hemesath Podiatry Pllc 2 $882
Joel A Rodriguez Md Pllc 1 $881
Shannon Dion 2 $879
Poppy Drive Inpatient Services Pllc 2 $878
Gastroenterology Clinic Of San Antonio Pa 7 $877
Noha Abdel-Salam 5 $875
Dr Thien Tran Dmd Pc 5 $875
Andrew Rossi Jr 5 $875
Teri Brooks Lovelace 5 $875
Edward M Wuensch Jr 5 $875
Texas Radiology Associates Llp 5 $874
Tpass 5 $870
Colonial Park Veterinary Hospital Inc 2 $867
Terrell County Isd 2 $867
X-Ray X-Press Corporation 1 $860
Service Objects Inc 4 $859
Houston Anesthesia Services Pllc 2 $857
Accurate Respiratory Inc 1 $850
Erica Jane Ormeno 1 $850
Faye Eunic Younger 2 $850
Forklift Training Specialties Llc 1 $850
Moore Land Surveying Llc 5 $850
Popi Stylianou 3 $850
Amer Assoc State Highway Tran Officals 1 $850
Advanced Clinician Pllc 4 $841
Right Track Drug Screening Llc 3 $840
Remote Cardiology Services Pllc 2 $840
Houston Carenow Urgent Care Pllc 2 $830
Vivian Ho 2 $824
Dr Jose Luis Valenzuela Psycotherapy Services Pllc 6 $816
Pulse Media Inc 1 $812
Orgami Risk Llc 1 $805
Guy Beveridge 1 $804
John Krajicek 1 $804
Stuart Greenfield 2 $800
Jon L Johnson 1 $800
Michael M Roberts 1 $800
Wiseman & Schwartz Llp 1 $800
Jeffrey Ehrenfried 1 $800
Lewis Mediation Llc 2 $800
Michael S Joyner 1 $800
Jeremy Vacek 1 $800
James R Kee 2 $800
Giles Clay Allred 1 $800
Codi K Spence Yancey Dvm 1 $800
Elliott Hudson 2 $800
Connie Lindley 1 $800
Baracel Eye & Vision Pllc 2 $799
The Competency Alliance Holdings Inc 1 $795
Treasurer State Of New Hampshire 1 $791
Qal-Tek Associates Llc 1 $783
Rentokil North America Dba Terminix 1 $780
Dora Roberts Rehabilitation Center 9 $772
Georginne Lim 2 $769
Precision Podiatry Pa 1 $760
Melissa Montemayor Trejo 5 $751
Laronica M Booker 1 $750
Cybermedicine Llc 2 $750
Robert L Newhall 1 $750
David A Marks Mdpa 5 $750
Trinity Forensic Psychiatry Consulting Pllc 1 $750
Texas School For The Blind And Visually Impaired 1 $750
Austin Alliance Group Llc 1 $729
Cory L Henrickson 1 $725
Austin Bar Association Inc 9 $724
Traysee Consulting Limited Liability Company 4 $722
Todd S K Agan 1 $720
Matthew Wagner 1 $720
Ucp Physicians Of Central Texas Pllc 3 $717
Relode Health Llc 2 $712
Tabitha Villarreal 2 $709
Thomas E Ducker 3 $704
Western Cpe 1 $702
Karen M Wuertz Dds 2 $700
Dannie S Yu 4 $700
Seung-Jun Lee 4 $700
Automated Business Systems 1 $700
Betrue Coaching Llc 6 $700
Matthew Dekow 4 $700
Kathleen M Nichols 4 $700
Axxerion Inc 1 $700
Shelley L Canada Dds 4 $700
Obhg Texas Holdings Pa 1 $695
National Assoc Of County & City Health Officials 1 $695
Idoc Telehealth Solutions Inc 2 $692
Vivian A Cervantez 1 $689
Jessica L Springer 1 $685
D'Hanis Isd 1 $683
New Lite Counseling Center Inc 2 $680
George C Bubba Burns 1 $675
Insiya Hussain 1 $675
Amarillo Area Bar Association 4 $675
Waco Center For Oral & Maxillofacial Surgery Pllc 1 $675
Ernie Luce Dds Pllc 2 $675
Dfw Anesthesia Services Pllc 1 $675
Tyler Nephrology Associates Pa 3 $673
Multi-Health Systems Inc 1 $669
Monique Yvonne Harris 1 $665
Erin Elizabeth Heath Dba Xcelevents 2 $665
Neuro Ir Of East Texas Pllc 1 $660
The Haven Wellness Center 1 $650
Serres & Son Plumbing Services Inc 1 $650
Sligo Law Group Pllc 1 $649
American Public Trng Llc Dba Graduate School Usa 3 $649
Graceland College Center For Professional 2 $647
Knowbility Inc 1 $645
Pender P Fitz Gerald 2 $639
Michelle Hallock 1 $633
Curtis L Walker 4 $630
Ysleta Independent School District 1 $624
Sean Mccartney 1 $621
Dandan Primary Care Llc 2 $613
Steve Boucher 2 $612
Adrian Guerra 2 $610
The Harlingen Endoscopy Center Lp 3 $604
Wildlife Revealed 2 $600
Jeomi Okwara 1 $600
Maria Gomelsky 2 $600
Holly Dluzniewski 2 $600
Sheila Modi 1 $600
Chun Li 1 $600
Arthur Westover 1 $600
Haichen Nie 1 $600
Srinivas Tenjarla 1 $600
Alexander Frolov 1 $600
Jinyang Hong 1 $600
Charli K Cottrell 1 $599
Pragmatic Works Training Inc 2 $594
Online Consulting Inc Dba Onlc Training Centers 2 $590
Interventional Partners Llc 2 $587
Vesta Telemedicine Solutions Pllc 7 $582
Smithville Isd 1 $577
Maudies Too Lp 3 $576
Language Line 6 $574
Paul Leal 1 $560
Kenneth Hayden 1 $560
Samantha Jane Holeck 1 $553
John Adair 1 $552
Water Educational Training Services Inc 1 $550
Janette Kurban 1 $550
Big Springs Texas Hospital Company Llc 1 $545
John T Conboy 2 $540
Diverse Health Consulting Llc 2 $540
Virtuox Inc 1 $540
American Trauma Society 1 $540
Samuel Salazar 1 $530
Robert P Godina 1 $530
Laurie Lynn Callaway 2 $525
Sally L Sheng 3 $525
Lillian C Lyons 3 $525
Ramu Vuppala 2 $525
Apg Dental P A 3 $525
Norris Training Systems Inc 1 $523
Dennis Chalaire 1 $521
Pathology Reference Laboratory Llc 4 $521
Patrick M Clarke 1 $518
St Davids Healthcare Partnership Lp Llp 1 $515
Valley Radiologists And Associates 4 $514
Complete Book & Media Supply Llc 2 $513
Marriott Hotel Services Llc 1 $513
William Wolfram Iii 1 $506
Texas Water Utilities Assoc 1 $505
Maria Obregon 1 $503
Zoi D Kondis 3 $501
Joseph A Nnadi 1 $500
Deep Ink 1 $500
Shelma N Young 2 $500
For Science Sake Llc 1 $500
Timothy J Cromie 1 $500
Germer Pllc 1 $500
Greater Fort Worth Association Of Realtors Inc 1 $500
Mary Suzanne Fowler 1 $500
Newton Consulting Services Llc 1 $500
Texas Accessibility Solutions 1 $500
David Crumbaugh 2 $500
Lisa A Gonzales 2 $500
Regional Organized Crime Information Center 1 $500
Maryam L Henry Bedford 1 $500
Cirkel Law Group Pc 1 $500
Stagg And Associates Pllc 2 $500
Karrisha Simpson 1 $500
Krstine Olefsky Dba Kristy Mezines 1 $500
Jennifer See Pllc 1 $500
Christy T Fleetwood 1 $500
Joy Sewing 1 $500
Design Security Controls Llc 1 $500
Luke Newton 1 $500
The Partnership Salty Llc 2 $500
Rvi Planning And Landscape Architecture Inc 1 $500
Hc Solutions Training & Consulting Pllc 1 $500
Richard O Dadeboe 1 $500
Amanda G Storaasli 1 $500
Adam Bradley Willmann 2 $500
Consult On Purpose Llc Dba Devi Shah 1 $499
Asce - American Society Of Civil Engineers 2 $498
Six Sigma Global Institute Llc 1 $498
Steven Schwartz 1 $497
Monica A Aleman-Smoot 1 $495
Morton Morrow Inc 1 $495
Texas Ear Nose & Throat Specialists Pa 3 $495
D Stafford And Associates Llc 1 $490
Law Office Of Dagnee Mckinney Pllc 3 $484
Austin Endodontics Llp 1 $480
Jennifer G Deen 1 $480
Menger Training Group Llc 2 $474
Precision Tracking Solutions Inc 1 $473
Titanium Emergency Group Llp 2 $469
Momentive Inc Fka Survey Monkey Inc 1 $468
Jose Acevedo 1 $460
Zeo Surgical Center Llc 1 $459
Lyndsay Wilson 3 $450
Kristy Simank 1 $450
Edwill J Butler 1 $450
Howard College 3 $450
Alpesh D Desai Do Pllc 2 $450
Alexander J Laros 1 $449
Pryor Learning Llc 2 $448
San Antonio Endocrinology & Diabetes Care 2 $447
St Davids Carenow Urgent Care 2 $445
Jarvis Parsons 1 $444
Gainesville Independent Testing Service Llc 1 $440
Akinropo G Longe 1 $435
Emmanuel S Olajide 1 $434
American Radiology Consultants Pllc 1 $432
Dental Assisting National Board Inc 1 $430
Shawna Renold 1 $425
Cortney S Groves 1 $425
Calawatie Cavita Sharma 1 $425
Gayle Patterson 2 $420
Elizabeth Garner 1 $420
Lisa M Bailey 1 $420
Yuri Campbell 1 $415
Francisco E Parodi Gonzalez 1 $415
Jacqueline M Carmona-Smith 1 $413
Sophia Potter 1 $403
Emergency Medicine Services Of Tx Pc 1 $403
Kimberley Watkins 1 $400
James D Pacey 1 $400
Jason C Miller Dpm 1 $400
Benjamin J Albritton Psy D P C 1 $400
Cisco Isd 1 $400
Donna L Mccutcheon 2 $400
Downing Ferguson Peeples Llc 1 $400
Kia Thornton 3 $400
The University Of Texas At Austin School Of 1 $400
Robert C Smith Md Pa 1 $400
Daniela Bucio 1 $400
Patti Solomon Rice 1 $400
Amber Berry 1 $400
Danika Cooper 1 $400
Texas Tech University Health 1 $399
Texas Hospital Association Foundation 1 $398
South Texas Spinal Clinic Pa 2 $397
Melissa F Armentor 1 $396
On Site Services 2002 2 $395
Shana L Clark 1 $395
Ut - Institute For Organizational Excellence 2 $395
Texas Root Canal Specialists Pllc 2 $390
Carl David Marx 3 $389
Cellco Partnership Dba Verizon Wireless 5 $386
Hardin & Associates Consulting Llc 1 $380
Don Champagne 1 $375
North Texas Arthritis & Rheumatology Pllc 1 $374
Head & Neck Surgical Associates 1 $372
Timothy K Engelhardt 1 $371
Urology Clinics Of North Texas Pllc 1 $371
Jeffrey M Staples Pc 2 $370
Ramona R Rogers 1 $366
Association Of Certified Fraud Examiners 1 $364
Marfield Inc 9 $362
Clerk Supreme Court 1 $360
Hea Appraisal Inc 1 $360
Imed Physician Network Inc 2 $352
Keller Isd 1 $350
Piney Point Omfs Pa 2 $350
Sonia G Louca 2 $350
Griffin Frey Pllc 3 $350
Subramanyeswara Sway Chinni 1 $350
Paula Cohen Schlemmer 1 $350
Responsive Ed Texas 1 $350
Michael E Guerra Md 2 $348
Progressive Ambulance Service Llc 1 $346
Micro Assist 1 $344
Beer Wholesale Jr Inc 1 $342
Ut Health Physicians 1 $341
Angela V Colmenero 1 $340
Cobblestone Systems Corp Dba Cobblestone Software 1 $340
Janet L Hasty 1 $340
College Pathway Consulting Llc 4 $338
Brad Mckechnie 2 $338
Ka Oi Chau 1 $336
Beeville Medical Clinic-Walk In 1 $330
Morpho Usa Inc 5 $330
Kara Sharman 1 $328
Highland Dental Laboratory Llc 1 $325
Texas State Agency Business Administrators Assoc 1 $325
Utmb Faculty Group Practice 4 $324
Baer Engineering & Environmental Consulting Inc 1 $320
Shelli C Ellis 3 $320
National Association Of State Workforce Agencies 1 $315
University Of Texas Health Science Center 7 $304
Ronald L Johnson 6 $303
Alexander Electric Inc 1 $302
Erin Spalding 1 $300
Vanessa Coca-Lyle Phd 2 $300
Rolando Rios 1 $300
Primary Health Physicians Pllc 1 $300
Duxin Sun 1 $300
Proactive Work Health Services 2 $300
Glock Professionals Inc 1 $300
Ondine Cleaver 1 $300
Shawn A Powers 2 $300
Carolyn Rose Hicks 1 $300
Kimberly Kay Shelton 2 $300
Courtny B Powers 2 $300
Brentson J Castillo 1 $300
Shawn Powers 1 $300
Society Of Petroleum Engineers Inc 1 $300
Chassity Allen Sullivan 1 $300
Jessica Marie Bills 1 $300
Michael Wang 1 $300
Collaborative Infrastructure Management Solutions 1 $300
Bureau Translations Inc 6 $300
Strong Foundations Consulting & Interpreting Llc 1 $300
Texas Public Broadcasting Association A Corporati 1 $300
Gabriela Hamdieh 1 $300
Bruce W Anderson 1 $299
Capital Area Occupational Medicine Pllc 3 $294
Usacs Critical Care Medicine Services Of Texas Pl 1 $294
Buena Vista Eye Care Pllc 1 $292
Austin Red Cedar Supply Inc D/B/A Johnstone Supply 2 $290
Stone Oral Facial Surgery Group 1 $290
Workers' Compensation Educational Services Llc 1 $285
Periscope Holdings Inc 5 $285
North Carolina Department Of Agriculture & 1 $280
Lango Llc 1 $276
Liberty-Eylau Independent School District 1 $274
Linda Mikolajek 1 $274
Wichita Falls Anesthesia Pllc 1 $269
Christina Whiting O'Rear 1 $265
University Of Texas - Austin 2 $260
Nicole Bermejillo 1 $250
Bradley S Craig 1 $250
Assoc Of Diabetes Care & Education Specialists 1 $250
Epiphany Dermatology Pa 5 $250
Joan Marie Perkins 1 $250
Daphny Ainslie 1 $250
Cecilia Powers 1 $250
Terry Scoggin 1 $250
Travis A High 1 $250
Tyler Junior College 1 $250
Solution Focused Psychological Pllc 1 $250
Horizon Professional Services 1 $250
Houston Bar Association 1 $250
Leroy Betts Iii 1 $250
Us Bank National Association Procard 2 $247
Margaret Ligarde 1 $245
Physicians Preferred Laboratory Ltd 2 $241
Solace Therapy Llc 1 $240
Firetrol Protection Systems 1 $240
St Davids Heart & Vascular Pllc 1 $240
Bdx Solutions Inc 1 $240
April J Fierros 2 $235
Miguel A Beltran 2 $235
Alexis Theriot 2 $235
Madison Rodriguez 2 $235
Pinnacle Dermatology Sc 1 $232
Lawrence P Tabbit-Humphrey 1 $232
Pathgroup Labs Llc 1 $231
Todd Stroud 1 $230
Insight Public Sector 1 $229
Texas Orthopedics Sports And Rehabilitation Assoc 1 $225
Doctors Express Of The Beaumont Area Pa 3 $225
Michelle E Duncan 1 $225
American Rx Group Llc 1 $225
Jessica M Garza 1 $220
Texas Police Chiefs Association 1 $220
Victoria Skiff 1 $218
Maria M Haynes 2 $218
Texasips Pllc 1 $217
Kourt Chatelain Dmd 1 $216
Ray Hubbard Emergency Physicans Pllc 2 $215
Tricounty Family Medical Care Group Llc 2 $215
Teri Lovelace Dds 2 $214
Woodsboro Isd 1 $213
Lubbock County Bar Association 5 $210
Joel Webb Vazquez 1 $210
Medical & Psychiatric Associates Of South Tx Pllc 1 $208
Occupational Health Centers Of The Southwest 1 $208
Murthy Gedala Pllc 1 $206
David C Devenport 1 $204
Sharon Hayes 1 $200
Brandon R Rose 1 $200
Jessica M Bills 1 $200
Daphny J Milligan 2 $200
Lauren Musgrave 2 $200
Lena Pope Home Inc 1 $200
Michael A Perez 1 $200
Sarah Jane M Puerto 1 $199
San Lucas Surgical Associates Pa 1 $197
Maese Fulmer Cpas Pllc 1 $195
Justin Feeney 1 $192
Vrw Lab Llc 1 $190
Cook-Fort Worth Children'S Medical Center 1 $189
Kathryn B Dolan 1 $189
Elite Medical Transport Of Texas Llc 1 $186
Betty Monger 1 $185
Big Bend Medical Group 2 $184
James J Fairchild 2 $180
Shaneika A Dilka Phd Lcdc 1 $180
Jeremy Fike Dds Pllc 1 $180
Tait Training Llc 1 $180
Texas Fire & Communications Inc 1 $180
Texas Food & Fuel Association 2 $180
Ellis County Medical Associates Pa 2 $180
Patrice F Gay 1 $180
Miranda Beall 1 $175
Mario Ascencio 1 $175
Tiffany Ford 1 $175
8554mylogo Dot Com Inc 1 $175
Lone Star Dental Anesthesia 1 $175
Danica M Harrell 1 $175
Jonathan Bradley 1 $175
Anita Graves English 1 $170
Tanya B Aragon 1 $169
Rolling Hills Chiropractic 2 $165
Matilda Ybarra 2 $165
El Paso Probate Bar Association 1 $160
Kaitlyn Martin 1 $159
Elizabeth M Cosgrove 1 $155
Information Systems Audit & Control Assn 1 $150
Kevin L Johnson 1 $150
National Assoc Of Drug Diversion Investigators 1 $150
Jessica C Martinez 1 $150
Sabrina M Garcia 3 $150
Stephen M Norwood Md 1 $150
William T Albright 1 $150
Hamm Md Pllc 1 $150
Zvi Kalisky Md 1 $150
Jay Martin Barrash Md 1 $150
Bruce Loyal Ehni 1 $150
Speed Of Light Xray Llc 1 $150
Sarah F Deluna 1 $150
Brian A Bohl 1 $150
Mark Davis 1 $150
Anthony E Ford Borgeaud 1 $149
Jessica Ramirez 1 $147
Mono Machines Llc 2 $147
Brown & Assoc Medical Lab Llp 1 $143
Us Anesthesia Partners Of Texas 1 $141
Browne Medical Llc 1 $140
Coastal Cardiology Pllc 1 $139
Audiology And Hearing Services Of Kerrville Pllc 1 $139
Pathology Associates Of North Texas Pa 3 $136
Process To Process Deliveries 1 $135
Valley Cancer Associates Pa 1 $134
Doctors Hosp At Renaissan 1 $132
Yezenia R Trevino 1 $130
R Bryan Gulley Dds 1 $130
Omar Cobo 1 $130
George A Rodriguez 1 $129
Leonard E Deal Md Pa 1 $127
B & R Dental Lab Llc 1 $126
James D Campbell 1 $126
University Of Texas Health Science Center Of San A 1 $125
Academy Of Certified Archivists 1 $125
Radiology Associates Of Abilene 1 $123
Paul W Lawrence 1 $120
Matthew H Tran 1 $120
North Texas Ophthalmology Associates Pllc 1 $120
Charity English 1 $120
Dallas Lung Care Pllc 1 $120
Sandra Balderas 1 $120
Andrea A Lofye 2 $120
Maria G Lopez 1 $118
Thomas Graham 1 $117
Corpus Christi Urology Group Pllc 1 $115
Foundations Inc 2 $113
North Texas Kidney Disease Associates Pllc 1 $112
Usacs Integrated Acute Care Services Of Texas Pll 2 $111
Sarah D Layne-Dotson 1 $111
Robert A Sosa 1 $110
United Oral Surgery El Paso Pllc 1 $109
Abia Hospitality Llc 1 $109
M Umar Burney Mdpa 1 $109
Brock Obarr 1 $108
Zakir Hussain A Shaikh 1 $107
William Alexander Childs 1 $106
Shawn Smith 1 $105
Rachid G Sinno 1 $100
Augustine Garcia 1 $100
Alexandria Brown 1 $100
Complete Foot And Ankle Care Of North Texas Pa 1 $100
Paula Bibbs-Samuels 1 $100
Robert Madrigal 1 $100
Dalia Cuellar 1 $100
Tmvca Inc 1 $100
Cynthia Hoffpauir 1 $100
Elite Orthopaedics Of Irving Pllc 3 $100
Kamaron G Kyte 1 $99
Carina Clark 1 $99
Christopher Carranza 1 $99
Joseph M Paul 1 $99
Pamela Calhoun 1 $96
Arturo Banda 2 $96
Paul Easley 1 $93
South Texas Physician Group Llc 1 $92
Eyet Llc 1 $90
Foot & Ankle Specialists Of Corpus Christi Pllc 1 $88
Eastern Texas Pathology Laboratories Llc 2 $88
Kerrville Ambulatory Surgery Center Llc 1 $87
Life Line Technologies Llc 1 $87
Full Fusion Llc 1 $85
Jessica D Mueller 1 $83
Dana A Wilcox 2 $82
Jason R Corona 1 $82
Holy Cross Obgyn Inc 1 $81
Steven H Lang 1 $80
Thrive Response Llc 1 $80
Sarif Currimbhoy Mdpa 1 $79
Diane A Glick 1 $79
Alma L Garza 1 $75
Jimna M Whitlow 1 $74
Joseph M Caporusso Pa 1 $73
Occupational Health Centers Of Illinois Pc 1 $70
Occupational Health Centers Of Kansas Pa 1 $70
Occupational Health Centers Of New Jersey Pa 1 $70
Occupational Health Centers Of Arkansas 1 $70
Lorna M Schwimmer-Staggs 3 $68
Jessica Alvarez 1 $68
Occupational Health Centers Of North Carolina Pc 1 $67
Jorge L Rincon Md Facs Pa 1 $66
Cadena Family Practic 1 $65
Timothy E Hill 2 $65
Harris Finley & Bogle Pc 1 $62
Edward Robles 1 $60
Jordan L Adams 1 $60
Sherrie D Snider 1 $60
Katelyn M Conner 1 $60
Phuong T Cao 1 $60
Erin Darnall 1 $60
Steven Haney 1 $59
James Jonathan Hickman 1 $57
Valley Radiologists & Associates 1 $57
Dshs Central Lab Mc 2004 1 $56
Ryan Borelo 2 $55
Robert S Smith Md Inc 1 $53
Michael Poole 1 $50
Lauren D Werner 1 $50
John C Clifton 1 $50
Association Of Western State Engineers 1 $50
Ntl Assn Of Gov'T Archives & Records Admin 1 $49
Sebastian Jose 1 $49
Tinnitus & Hearing Experts Pc 1 $48
Hsi Emergency Care Solutions Inc 3 $45
Lufkin Radiology Associates Pllc 2 $43
Kirk S Mitchell 1 $43
Staples Business Advantage 1 $41
Patient Support Services Inc 1 $41
Stacy Sharp 1 $40
Tina C Dukes 1 $40
At The Heart Of Teaching Learning & Leadership Llc 1 $40
Daniel J Bowers 1 $40
Jasmine Garcia 1 $40
Nancy Adams 1 $38
Swapna Jos 1 $38
Cynthia C King 1 $38
Denise A Garcia 1 $37
Omar Chavez 1 $35
Jennifer Miller 1 $35
Eddie Davis Dpm Pllc 1 $35
Christopher Lippke 1 $35
Questcare Intensivisits Pllc 1 $31
Sheri A Hard 1 $30
Alan R Fenter 1 $30
Zali Cross 1 $30
Summit Professional Eduction Llc 1 $29
Christopher B Childress 1 $27
Hospital Medicine Services Of Texas Pllc 1 $26
Bank Of New York Mellon Trust Company 1 $25
Tim C Pierce 1 $25
Gloria C Rivera 1 $25
Marialyn P Barnard 1 $25
North Texas Electrophysiology And Arrhythmia Consu 4 $24
Matthew Miller 1 $24
Samuel F Lopez Jr 1 $23
Joe H Golson 1 $22
Rhonda C Silverman 1 $21
Stephanie Tollett 1 $21
Nakyla Darby 1 $20
Alexandria S Robertson 1 $20
Heath C Bozeman 1 $20
East Texas Foot Associates Pc 1 $20
Identogo Center 2 $20
Cooper G Buxkemper 1 $17
Pathgroups Lab Llc 1 $15
Angelica M Sanchez 1 $15
Krystal L Alvarez 1 $15
Privia Medical Group North Texas 1 $15
Dudley Land Company 1 $12
Hema L Korlakunta Md Pa 1 $11
Pineywoods Pathology Pa 1 $10
South Texas Radiology Group 1 $9
Jq Infrastructure Llc 1 $0
William Spurlock 1 $0
Azim Amin Karim 1 $0
Jesus Antonio Lopez 1 $0
David A Hill 2 $0
Breakwater International Llc 1 $0
Cooperative Personnel Serv Dba Cps Hr Co 1 $0
Andrew Michael Klymiuk 1 $0
Michael C Miller 1 $0
Lourdes Ramirez Bosquez 1 $0
Kimberly Diane Shipper 3 $0
Marcos Hiroshi Ikeda 1 $0
Rita Abdeladim 1 $0
Project Control Of Texas Inc 1 $0
Texas Credit Card Procurement Program 2 $0
Emad Bishai 1 $0
David Wilhite And Nancy Wilhite 1 $0
Vladimir Grebennikov 1 $0
Raleigh Arnold Smith Md 1 $0
Eugene C Toy 2 $0
Alex Guevara 1 $0
Naveendra Korivi Do 1 $0
Hiep Andrew Cao 1 $0
Michael Gallagher 1 $0
Kaeppel Consulting Llc 1 $0
Thomas Tung Tran 1 $0
Horne Cpa 2 $0
Jq Engineering L L P 1 $0
Texas Military Department 2 $0
Mountjoy Chilton Medley Llp 1 $0
Charles Mild 1 $0
Darrella Cooper 1 $0
TX Worksite % flags in red when under 50% of a vendor's matched H-1B filings list a Texas worksite (with at least 3 filings, to avoid flagging on a single data point). This surfaces vendors paid by Texas whose disclosed H-1B footprint is mostly elsewhere — worth a closer look, not proof of anything on its own; the worksite field is self-reported at filing time, not a real-time record of where someone actually worked.

How matching works: vendor names are stripped of punctuation and common legal suffixes (LLC, Inc, Corp, etc.) down to a "core" name, which must match exactly against a normalized H-1B employer/secondary-entity name — full-text search is used only to find candidates quickly, and every candidate is re-verified against the exact core before counting. This runs against a precomputed cache (rebuilt via h1b_build_vendor_cache.php), so results reflect whenever that was last run — re-run it after loading new TX months or new LCA quarters. A vendor showing "—" means no LCA record's name matched this exact core; it does not confirm they have no H-1B workers under a different corporate name.